CAZyme Information: MGYG000001692_01458

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_01458
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000001692_14|CGC2	44293.8	8.2393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 36355; End: 37548 Strand: +

Full Sequence      

MEWIMIVFWLCAALVVYHHVGYPLLLKWVGKRACSRQHQPTPHQRGFRTEVGDEQLPAIT
LVMPIYNEATTLAAKLQNLASLDYPADKLAVHLHFDGCTDDSYAIALCQLGDPALLQLQI
RLFEHPRNRGKVAVLNEAMTHIDTPLVAFSDVSALLPIDSLLLAAAHFQDPAVGVVGEAY
RFWQPGSQGEASYWRYQSQIKLCESALGSMLGAHGAFYVMRSDCLAPLAPDTINDDFILP
MQAIARGYKAVYDNRCAALELEVSDAQLESKRRKRIGAGNTQQLLRLLPLLHPRFGWVAF
NFASGKGLRVLMPLCLTLLWLCAIPLAIHSPLFVALLAAQLLGYALVLLIQLTPLHNWPG
LFRKIHYLVLGHWYNGIGSLRYGLRMLTRPTTQERAA

Enzyme Prediction     

No EC number prediction in MGYG000001692_01458.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06439	CESA_like_1	1.29e-97	18	283	1	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	3.39e-20	3	359	12	364	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	6.19e-19	61	236	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.58e-10	57	176	1	120	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
pfam00535	Glycos_transf_2	4.37e-10	60	182	1	118	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKF99844.1	2.88e-292	1	397	1	397
ASX11846.1	4.78e-291	1	397	1	397
QSR55772.1	3.92e-290	1	397	1	397
QSR43252.1	3.22e-289	1	397	1	397
BCO14115.1	1.31e-288	1	397	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	3.35e-16	19	251	13	237	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.38e-16	19	251	14	238	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	6.18e-10	57	242	108	298	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
307	329
333	355