CAZyme Information: MGYG000001692_01592

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_01592
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158		17863.6	9.5968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 191312; End: 191788 Strand: -

Full Sequence      

MSSIYSLLKFEEGWREKPYLCTEGYPTVGFGFRIGPKGANIKHYQFTLPVRAGEAWLDSL
LDELELEMRRLPQPQLALALTACTPYPARQAILKSMAYQMGVQGLAAFKNTLQAVIEQRW
NDAAAGMLNSRWAKQTPNRAKRHAEQMRTGLWAPEYGA

Enzyme Prediction     

No EC number prediction in MGYG000001692_01592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	4	137	7.8e-16	0.8686131386861314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	3.99e-56	3	154	1	146	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	2.94e-19	3	150	174	331	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	3.99e-05	7	37	4	34	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16902	pesticin_lyz	2.36e-04	82	145	116	176	lysozyme-like C-terminal domain of pesticin. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
cd16901	lyz_P1	0.002	12	37	14	39	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ86204.1	1.96e-77	1	157	1	155
QDH46539.1	2.85e-61	1	156	6	157
QEG09029.1	3.45e-61	1	156	1	152
QDH46775.1	4.05e-61	1	156	6	157
QDH46919.1	8.16e-61	1	156	6	157

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2B7X_A	5.76e-20	3	152	2	164	ChainA, Lysozyme [Tequatrovirus T4],2B7X_B Chain B, Lysozyme [Tequatrovirus T4],2B7X_C Chain C, Lysozyme [Tequatrovirus T4],2B7X_D Chain D, Lysozyme [Tequatrovirus T4]
1QTZ_A	1.40e-19	3	152	2	158	ChainA, PROTEIN (T4 LYSOZYME) [Tequatrovirus T4]
1ZYT_A	3.90e-19	3	152	2	158	ChainA, Lysozyme [Escherichia phage T4]
137L_A	5.49e-19	3	152	2	158	ChainA, T4 LYSOZYME [Tequatrovirus T4],137L_B Chain B, T4 LYSOZYME [Tequatrovirus T4]
190L_A	7.72e-19	3	152	2	158	ChainA, LYSOZYME [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00720	4.10e-14	3	152	2	158	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2
Q556F2	4.62e-14	1	150	2	164	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
Q86AA1	2.85e-09	1	150	2	164	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1
P16009	9.89e-08	3	150	175	334	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_01592.