CAZyme Information: MGYG000001692_02299

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_02299
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826		92517.64	4.7435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 424635; End: 427115 Strand: +

Full Sequence      

MFRKSLLSVTLSVALFGLTACNDNDSSSPAAPSATLANQYQNVIDRSGTPRQFRDFDSYS
NLKYNPLLDLGAWHGFLLPASDSEWGGFTGPMVIAEEYSLFFASELDKLTLSDENGRAFP
LTSASKQALYAIPGALVQRFEFESFTLELELRYGDARTALVRTRLINHTDAPLTLKLNWQ
GELLNQWDANKTVAEQYPAWTRTISQTERGVAFQFGKLRSTWNIMQSGSASYRIDRTLSS
RTTLDEQGLGYVSEASLTLAAKGQQDIYTLQSYVHSSDEASRFEQSRQALLADPASHFDD
SIRRWEDYLARGLSNQGIPESERRIAVKAMETLNGNWRSPAGAILHDGVTPSNTARWFDG
VWAWDSWKHAYAMAHFNPEVAKNNVRAMYDYQIQADDPVRPQDAGMVIDAVFYNKLADRG
GDGGNWNERDTKPPLSAWAIWEIYSATQDKAFIAEMYPKIQAYHDWWYRARDNNRNGIIE
YGATRHVEHNDEFGNITFKVQYPTGVPAGLDLSSCTNEGDGWYGCAGMALYQQVLSVGGY
ADMDIGAQHGAGWESGMDNAARFGFIEQDQLKRYADKTYGGDLAKARQDWNVFFFENHQD
DGSLIGFSIDQESVELNAFLAKEKRILADMAELLGKPDEASRYREGATQLAGYINSCLFD
EASGFYYDRQIAQGDLPDANGCVGKLLTARGRGPEGWSPLWAEVADQEKAARVREVMLNA
QEFNTRVPLGTAALTNPAYDPDIYWRGRVWLDQFYFGVKGLENYGYRSDAQQLVNKLFSN
AEGLAGSGPIRENYNPETGAMQGASNFSWSSAHLYMLYRNFLKTEG

Enzyme Prediction     

No EC number prediction in MGYG000001692_02299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	2	823	2.7e-240	0.9982456140350877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	2	824	1	786	alpha-glucosidase; Provisional
pfam01204	Trehalase	9.81e-10	614	817	305	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.86e-08	573	782	313	504	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	2.39e-08	353	824	277	606	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	5.18e-08	608	811	246	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR55080.1	0.0	1	826	1	826
AHX70555.1	0.0	1	826	1	826
AKJ33659.1	0.0	1	826	1	826
AGM45122.1	0.0	1	826	1	826
AJE35464.1	0.0	1	826	1	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	8.01e-265	37	825	2	760	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.57e-264	37	825	2	760	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.47e-264	37	825	2	760	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.06e-257	37	825	3	761	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	6.53e-140	37	572	328	858	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	4.83e-264	34	825	22	783	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	3.09e-13	362	812	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	5.42e-13	362	812	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_02299.