CAZyme Information: MGYG000001692_03467

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_03467
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		46949.93	6.9528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 173335; End: 174591 Strand: +

Full Sequence      

MTFKVAFRLDAGAEIGLGHLMRCLAIADRLHAAGAECHFLCHDLPAHLLSLLRPHHHHPL
SALDDAGPLPGLQPDWLVFDHYRIDQRLETQLAAHCGRILVIDDLADRPHHCQLLLDQGP
LRRAADYQPLTPADCRLLLGTDYALLRPAYRQLARQHASQWQRGLVCFGGADPAGACLIT
LNSLARLPWARTIRWTLVAGGANPFWPELEQRVAKLADLDLVLLRQSDQMADLMSRHDFA
IGAAGGMTWERACLGLPTLAVPIVDNQQFNDQVIARFQLAERLTLSELAEPERLLQALQR
LEQQSDNYRRRGQQQVDGLGLDRLTARLLPQPDYQLLPDGQQWQLRHDGKLLLTLTLNGQ
RLTWQATRPLQPTAWQELAHRLQTIFSQFPLYLAEPPQIAPPAPWQPAPQGWQLGTGV

Enzyme Prediction     

No EC number prediction in MGYG000001692_03467.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	8.08e-121	4	274	1	279	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	2.41e-50	4	326	2	318	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK00726	murG	3.74e-05	228	313	244	333	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.56e-04	228	310	244	330	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASX09851.1	2.55e-308	1	418	1	418
AHV37395.1	8.53e-307	1	418	1	418
QNF24360.1	7.01e-306	1	418	1	418
QSR45430.1	5.76e-305	1	418	1	418
ANT66137.1	8.18e-305	1	418	1	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBM_A	9.17e-21	4	268	2	257	ChainA, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819],3HBN_A Chain A, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1W0U6	3.56e-21	4	268	2	257	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=pseG PE=3 SV=1
Q0P8U5	4.88e-21	4	268	2	257	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pseG PE=1 SV=1
P39627	2.90e-13	10	326	8	329	Spore coat polysaccharide biosynthesis protein SpsG OS=Bacillus subtilis (strain 168) OX=224308 GN=spsG PE=4 SV=2
Q58462	6.57e-08	4	261	2	268	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_03467.