CAZyme Information: MGYG000001693_00749

Basic Information

• Species: Halorubrum lipolyticum
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Halorubrum; Halorubrum lipolyticum
• CAZyme ID: MGYG000001693_00749
• CAZy Family: GT66
• CAZyme Description: Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041		112815.89	3.8637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001693	3425042	Isolate	Canada	North America

• Gene Location: Start: 96905; End: 100030 Strand: +

Full Sequence      

MSQQTDAVGNEGESSLDTLRRWYHVPVLLGTLAFMLWTRLRSYGNFIQNGEVYFRGNDPW
YHLRETNYLLENWPNTLPFDVWTGFPIGNQVGQFGTLWDHILAISIWIARPIMGSTEEVM
LIMAPIAGTLVAIPTYFIARRFVDRFAALAAVIVLALLSGTFFSYSLVGFPDHSAAEVLF
QSLAVLAFLVAFAVADREAPVWELVIDRDWTALKRPAAYAAAAGVALGLYMWTWQPGVLM
VGFTGVFLAVKITSDVSHGTSPEPTVFVGAIAMAVSGLMQVIPLNQFAFSPTGYSLLQIV
LPLGVAVGSVFLAWLARQWESRDLDTASYPPAVGGLILASAGVVWLAIPSLWSTLVSNLL
NFVGFSASASFQTIGEGQPPLQEAAFSDFVLSQYGLAFFLALAAVLYIVARPLYRSDDTN
HTLYIPAALAVVGSVYAVPQLYDAIGGVVGVSWQVVGLVIAAAFLVGTTFLVEYDTEELY
FVVWAAFIGSAAFTQTRFNYYLAVIVAVGTAYFLQVSFDALDLSSLDALRNVEGWQVLTI
AAVLAILIVPLVGVATPVWTAGNSTQPGSVTEWDEGLQWMNDETPTPGELEGADNPMELY
GTYERPADGDFDYPEGAYGVQSWWDYGHWITTRAERIPNANPFQQNAGAAADYLLAPSEA
ESTEVLASQSDEGANTRYVMVDWQMASPNSKFNAPVTFYSGNETVQDFNERLYQQTEQGG
FQPVLQTRTQRYHESQMIRLYQHYGSAVDPEPVVVDWESQTAQTSDGGQVEIGVVSGDGG
AIQQFDNMSAARSYVEEDGSAQVGGVMGLPSERVEALEHHRLVHATQSPGQSPYAQQAAV
LAQRFGVDLQSVFGETLFGAYQDNFVKTFERVPGGTIEGSGATPGEEVEATVEMEKPTGQ
TFEYTQYAEADENGNFELTVPYSTTGYDEFGPENGYTNTSVRATGPYNVTTEQTTDDDLY
TTQRVGQVEVTEGQVVGEDDAAATVELEEEVVDCPSGDPECPVDQSDDGGNNDGNTTNET
ASVAAGDSVTSESIGLDSASA

Enzyme Prediction     

EC	2.4.99.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	33	694	2.4e-118	0.8311688311688312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04154	archaeo_STT3	0.0	25	978	1	817	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
COG1287	Stt3	8.94e-72	20	944	14	773	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam18079	AglB_L1	7.63e-23	874	979	1	86	Archaeal glycosylation protein B long peripheral domain. This domain is found in Archaeal Glycosylation B protein (AglB-Long) in A. fulgidus. When the domain, known as peripheral l (Pl), is combined with the central core (CC) and insertion (IS) sub-units, they form the C-terminal domain. It is thought that the C-terminal domain may contribute toward the increased thermal stability of the AglB proteins in the hyper-thermophilic.
pfam02516	STT3	1.59e-11	49	363	24	323	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
cd17321	MFS_MMR_MDR_like	2.02e-04	270	451	179	363	Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWC20175.1	0.0	1	1020	1	1022
QKY15550.1	0.0	1	1023	1	1023
QUO46923.1	0.0	1	1025	1	1031
QAY19730.1	0.0	1	1020	1	1021
ACM56659.1	0.0	1	1018	1	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WAJ_A	5.63e-44	20	923	9	827	Crystalstructure of the Archaeoglobus fulgidus oligosaccharyltransferase (O29867_ARCFU) complex with Zn and sulfate [Archaeoglobus fulgidus DSM 4304],3WAK_A Crystal structure of the Archaeoglobus fulgidus oligosaccharyltransferase (O29867_ARCFU) in the apo form [Archaeoglobus fulgidus DSM 4304]
5GMY_A	7.47e-44	20	923	9	827	ChainA, Transmembrane oligosaccharyl transferase, putative [Archaeoglobus fulgidus DSM 4304],7E9S_A Chain A, Dolichyl-phosphooligosaccharide-protein glycotransferase 3 [Archaeoglobus fulgidus DSM 4304]
3WAI_A	2.77e-15	572	923	373	698	Crystalstructure of the C-terminal globular domain of oligosaccharyltransferase (AfAglB-L, O29867_ARCFU) from Archaeoglobus fulgidus as a MBP fusion [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYH4	1.92e-274	14	995	11	1013	Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglB PE=1 SV=1
O29867	2.97e-43	20	923	9	827	Dolichyl-phosphooligosaccharide-protein glycotransferase 3 OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=aglB3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	38
120	139
146	168
178	195
216	238
265	287
294	316
326	348
355	374
389	411
423	445
450	472
479	496
500	517
537	559