CAZyme Information: MGYG000001693_02081

Basic Information

• Species: Halorubrum lipolyticum
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Halorubrum; Halorubrum lipolyticum
• CAZyme ID: MGYG000001693_02081
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000001693_28|CGC3	74457.21	4.1766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001693	3425042	Isolate	Canada	North America

• Gene Location: Start: 143394; End: 145400 Strand: -

Full Sequence      

MAIGVCYFPEHWPRTRWERDIERMAEVGVEYVRMGEFAWAQLEPERGAFRFDWLETVLDL
IDDHGLNAVLCTPTATPPRWLVDDHPSILQEEADGTTREFGSRRHYCFNSEAYRLETRRI
VDALADRFADHPSVAGWQVDNEFGCHGTLRCYCDDCADAFSDWLAERYEDPDELNEAWGT
DFWSQRYDSFDAVLPPRHTAADHHPGQLLDYYRFSSDSAVSYNELQADRLRAANDEWFVT
HNFMGHYEALDAYDVSESLEFASWDSYPTGFAQELDDPSSDELVAGNPDQIGFNHDLYRS
AGDGPFWVMEQQPGDINWPPYSPQPAEGSVRLWAHHAVGHGADNVVYFRWRRCLEGQEQY
HSGLLERDDSPGRGHDEAGAAASELSTLPTDGAVDADVALLHDYENLWATGIQPNSPDFD
YFDHQRTYYEALRSHGVDVDVVHPSTDLSEYSAVVAPTLYLVDDELAERLEAYVAAGGQL
CVSIRSGVKDRANKLLESRPPGPFAELVGATVEEHESRHPSQAQSVTYEGETHAYHTWNE
RLDASEATVIGEYDAGEPAGYPAIVRNEVGAGAVTYCGVWPSDDLARRLVADLLDRAETP
RLDEPLPSTVRVSSRGDAAWVVNFGSEPVSVTAPGAADRLLGDETVGAFDCAVVDAPGTA
LSIDTGSR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	6	386	1.2e-151	0.9946091644204852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	5.19e-180	6	388	1	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	8.85e-163	1	655	16	671	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	1.69e-65	396	600	1	207	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	3.07e-31	398	528	1	131	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG3250	LacZ	2.23e-05	37	372	305	585	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH39085.1	0.0	1	664	1	666
QUJ73783.1	1.10e-314	1	663	1	663
QLG28913.1	4.18e-311	1	663	1	676
QSG09945.1	7.55e-309	1	655	1	653
QSG10967.1	4.34e-308	1	655	1	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	3.98e-284	1	627	1	640	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	2.45e-187	3	653	2	641	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6Y2K_A	8.90e-164	1	653	1	652	ChainA, beta-galactosidase [Marinomonas sp. ef1]
3TTS_A	2.91e-106	4	646	12	658	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
5E9A_A	2.45e-96	4	634	42	680	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94804	2.45e-290	1	655	1	652	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
B9LW38	2.18e-283	1	627	1	640	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
O69315	1.34e-186	3	653	2	641	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
Q8GEA9	1.90e-186	3	653	2	641	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
O54315	5.55e-183	3	653	2	641	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001693_02081.