CAZyme Information: MGYG000001693_02113

Basic Information

• Species: Halorubrum lipolyticum
• Lineage: Archaea; Halobacteriota; Halobacteria; Halobacteriales; Haloferacaceae; Halorubrum; Halorubrum lipolyticum
• CAZyme ID: MGYG000001693_02113
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
949		104816.75	4.48

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001693	3425042	Isolate	Canada	North America

• Gene Location: Start: 184713; End: 187562 Strand: +

Full Sequence      

MITESPRAADVPLVQGRTVADVYVDEADAAVAGVAASDLRDDIERVTGERPALRHSLEDC
SDTAVVVGTVGRSAGVDACAAAGDSAADRLRGQRESYRIETLRDPTPELDRCVLVTGSDR
RGTAYGAYELSKRVGVSPWYWWADVAPTERETVAVEAGSYADGPPSVTYRGIFLNDEDWG
LRPWASETFAPEDAEDRPGIGPKTYERVFELLLRLKANTIWPAMHPGTKAFYRYADHAEL
ADRYAVVVGTSHCEPMHRNNVDEWDAPAEAWNYETNRERIVEYWRSRVESVADYENVFTV
GMRGIHDSGMPGGETRGETIDLLQRAIDDQRRLLGEAHDVPVDDVPQVFCPYKEVLDRYR
EGVDVPDDVCLMWPDDSHGYVRELPTEAERERPGGSGVYYHLSYWGRPHDYLWLSSVPPA
LVKHEMTRAYDAGARECWVVNVGDIKPTEKEMEYFLDLAWDVERVRDTSTDSWLTAWADR
EFDGGHASEIAAILREYYRLARSRKPEHMGWSTVYPDTPPDEPAYSVVDDGDEARRRVES
FDRLVERAEAVADDLDPNHWPSFYELVLYPVRCAAAMSEKHLHAARSRRYAGQGRVSANR
YADRAVAAHERIAAEARYYNEDLRDGKWDGMASRNPRELPVFASPSTASVTPYDGSALGV
VPEGHERPVRGDESVPPTLPTVHERVDRDRFIDLFSRGTDPVEWTAETSDDWITVSESGG
TVGDERRVWIGVDWAVAPAGRVTGTVTIAAEGARKPVRVEGVAPAVDPGADFAVVDGAAA
VEAEHFSRAAPGADGDGWAESDVPGRVSGATMAVDLPPDAPTDRSVADAPRLDYEVDVPS
TRTVAVEVHCVPTQALNEGRDLRYAVGVGDAGPAIVSIDPDGGEHDPEWQRNVLRGAAIG
TTTHRIERTGRQTLRLWGLDPGLVVDRIVLVADGERSTYLGPRETAVGD

Enzyme Prediction     

No EC number prediction in MGYG000001693_02113.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	10	928	1.4e-236	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	163	508	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.50e-39	776	944	6	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	2.50e-05	702	759	26	80	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	0.005	698	750	26	90	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG01349.1	0.0	1	947	1	946
AHG01821.1	0.0	1	948	2	948
ADB62762.1	0.0	1	945	6	959
QRV17780.1	0.0	1	945	1	955
AEH39042.1	0.0	3	945	25	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.37e-150	20	948	23	936	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	9.79e-144	65	642	68	625	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
6NPS_A	4.43e-108	28	945	26	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	5.87e-107	5	631	38	639	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	8.32e-107	13	634	19	627	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995209	0.004674	0.000099	0.000010	0.000006	0.000015

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001693_02113.