CAZyme Information: MGYG000001694_01082

Basic Information

• Species: Enterococcus faecalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus faecalis
• CAZyme ID: MGYG000001694_01082
• CAZy Family: GH94
• CAZyme Description: 1,2-beta-oligoglucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1091	MGYG000001694_1|CGC13	124554.44	4.8918

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001694	2810675	Isolate	not provided	not provided

• Gene Location: Start: 1092085; End: 1095360 Strand: +

Full Sequence      

MQIKKLKQADTVATFLETGDLKELNSYGMMINQLEGNPLDGSMNQLYLRIITGDTINYRP
MIGSNSQSDFYLSDNQLTWRGEFEAVRYQVDFRLGPSNQWFWRVNVTGTGLVDIVYGQDI
GLATKGAVQSNEAYVSQYLDHHIWQEGEELVVLSRQNQPQNEKFPALIQGSFQKLVGYST
DGYQFFGRSFKQTNTPEALGKRYLANEVYQYEFAYTALQTEAVQLTNESKEFVFYGAVTE
THPQALAEPFLSKEAFQAIYETVTFDSLEETQDSPTKLLGEPITGNPLTEEELAALYPLQ
TQIEKVAGQTYSFFTENYHHVVLQEKEIAMERAHGHILLSGKGLTVDEPLLSTTVYMYGI
FNSQVVLGNTTMNKLMSNSRNALNVMKRSGQRIYILENGLWRLLTMPSAFEMGLNSATWY
YKLPKDTIRVRTFTSPDSRVIQLEVTSQKDAYMWAVSNHLLLGPEEVPTYQLEQTGKTLR
VTGNHSATENYYPELTYTLTVDKSFQVTDSTLFGGAEADLLVLAIEKTQKFSLLITGSIE
DQALVNTPLDFEKAESQYLAFINGLLHHFELTHTDSSVQQMNQLTRWYTHNMLVHYLSPH
GLEQYGGAAWGTRDVSQGPTEFFFATQQPKIVASIIQHLFENQFEDDGNWPQWFMFDRYE
EQKASESHGDIIVWPLKVVTDYLEQTADYSILATEIPYTSRKDNHKTKETASLFEHLKKE
INYIEQHFLPETFLSCYGDGDWDDTLQPYDNRLKEQMASSWTVALTYQVLKKFAALITEI
DATYSQHLAILVAGIKNDFQKYMLADETIPGFIYMETPETFEQMIHPNDQKTGIQYRLLP
MTRSMLAELLTPEQVSHHLEIIEKELTFPDGVRLMNKPANYRGGVSTNFKRAEQAANFGR
EIGLQYVHAHIRYTEAMAKIGQRDKTWQALMQINPVQLKEVVHNAELRQANAYFSSSDGD
FKTRYESQENFGKLKDGSIGVKGGWRIYSSGPGIYLNQLITAVLGIRQKAQSVVFDPMLP
EKLSGLTLTYQLFDKPVTYKFYPNQSAKIVIDGQEVPFKFEENPYREGGMEVQKDEVLSL
LNEASVIEIYH

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	68	1057	6.7e-195	0.972007722007722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	0.0	3	1078	10	1053	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	7.05e-12	630	953	82	384	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUE55683.1	0.0	1	1091	1	1091
QSO18103.1	0.0	1	1091	1	1091
QFY92240.1	0.0	1	1091	1	1091
APE72284.1	0.0	1	1091	1	1091
VEE95505.1	0.0	1	1091	1	1091

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H41_A	2.20e-279	6	1090	13	1111	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H41_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H42_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg],5H42_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg]
5H3Z_A	1.39e-271	6	1090	13	1111	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H3Z_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H40_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg],5H40_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg]
3QDE_A	3.56e-09	546	1056	292	790	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
5NZ7_A	1.52e-06	668	1056	578	988	ChainA, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ7_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_A Chain A, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus]
4ZLE_A	9.53e-06	523	935	260	653	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92AT0	1.67e-303	3	1086	4	1078	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1
B9K7M6	1.31e-07	547	1056	294	792	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001694_01082.