CAZyme Information: MGYG000001694_01297

Basic Information

• Species: Enterococcus faecalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus faecalis
• CAZyme ID: MGYG000001694_01297
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205	MGYG000001694_1|CGC17	23601.07	7.9522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001694	2810675	Isolate	not provided	not provided

• Gene Location: Start: 1321052; End: 1321669 Strand: +

Full Sequence      

MRRVRKIIYKIMLLLFVGLVAGLGYLGYKIHQNVETVMTFEKQVEAEVKKNKIPEYKTLA
LAIIYTESKGKSGDIMQSSESVYGQQEVIETPEESIAHGVKFLAEALAKAKEAGCDEWTG
VQAYNYGLDYIQFVKERGGKHTTELAEEYSREVLSPLLGNDQNTKYRYYRWQALVYNGGY
LYQNGGNMFYAEIVKMNRWFIEKLN

Enzyme Prediction     

No EC number prediction in MGYG000001694_01297.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.20e-74	34	198	1	165	Lysozyme-like.
cd16891	CwlT-like	8.67e-61	40	197	1	149	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVW74702.1	2.25e-145	1	205	1	205
QUE55495.1	2.25e-145	1	205	1	205
QFY95356.2	2.25e-145	1	205	1	205
QRG98729.1	2.25e-145	1	205	1	205
QSO25371.1	2.25e-145	1	205	1	205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	6.23e-21	37	194	24	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	4.72e-20	37	194	26	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99ZN9	1.25e-47	25	205	18	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	5.03e-47	25	205	18	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	5.03e-47	25	205	18	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
P0DC90	4.04e-46	25	205	18	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	4.04e-46	25	205	18	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997544	0.000426	0.001170	0.000002	0.000002	0.000880

TMHMM  Annotations     

start	end
7	28