CAZyme Information: MGYG000001694_01916

Basic Information

• Species: Enterococcus faecalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus faecalis
• CAZyme ID: MGYG000001694_01916
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000001694_1|CGC27	24451.54	4.8419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001694	2810675	Isolate	not provided	not provided

• Gene Location: Start: 1933074; End: 1933715 Strand: -

Full Sequence      

MKWGINEVSNYQKKRKKQLNLPKLFLGVVVVGLAFVFSLSVLSDSDKGQSESVNRQNENI
SKEEFVAEITPYARELQESYGVLPSIIMGQAVLESNFGQSQLASKYNNLFGIKAYGNQPK
VNLETKEYVNEVWITIQGDFRVYDNWEESMRDHTKLFVDGVDWDPNLYEKVLLAKNYKEA
AQALQDAGYATDPTYADKIIHVIEEYNLNKYDR

Enzyme Prediction     

No EC number prediction in MGYG000001694_01916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	70	208	1e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.32e-69	23	213	5	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
TIGR02541	flagell_FlgJ	1.00e-39	61	203	147	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
smart00047	LYZ2	6.27e-39	57	212	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	1.25e-37	61	203	151	294	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK08581	PRK08581	4.55e-36	34	212	295	472	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZK93896.1	5.09e-155	1	213	1	213
AVR92389.1	5.09e-155	1	213	1	213
QWW15810.1	5.09e-155	1	213	1	213
QOG34252.1	5.09e-155	1	213	1	213
QDD47452.1	5.09e-155	1	213	1	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.88e-27	65	212	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.58e-20	40	212	42	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.14e-18	60	205	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.00e-18	60	205	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.32e-17	65	203	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.51e-44	12	212	3	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	3.65e-24	12	212	14	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	4.70e-23	12	212	14	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	6.56e-23	12	212	14	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	1.02e-21	8	212	1	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000036	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
21	43