CAZyme Information: MGYG000001694_02673

Basic Information

• Species: Enterococcus faecalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus faecalis
• CAZyme ID: MGYG000001694_02673
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		23455.61	6.8814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001694	2810675	Isolate	not provided	not provided

• Gene Location: Start: 2717297; End: 2717935 Strand: -

Full Sequence      

MKKMMLFIIAVGATMISVFALGDAQQSYAHGYVDSPVSRVKNAEANGFGWGPGQDSSQPE
IITTPQGIEAPTKLLDTGQLNGRLPSAGLASYSKLDEQTATRWVKSNITTGENNFKWAMT
AKHKTNRFRYYMTKPGWNPNAPLTMDEMELIGIVGQPIGQDLPPGQGFMVNDTETHRIKI
PADRKGYHVIYAVWDINDTINSFYQAIDVNVQ

Enzyme Prediction     

No EC number prediction in MGYG000001694_02673.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	30	210	1.3e-46	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	5.73e-60	2	210	1	192	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.71e-55	1	211	1	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	1.32e-54	30	210	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	4.85e-46	30	209	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PHA03387	gp37	1.27e-06	120	209	159	248	spherodin-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO73735.1	2.00e-156	1	212	1	212
QUE56719.1	8.15e-156	1	212	1	212
QJC68762.1	8.15e-156	1	212	1	212
QSO26567.1	8.15e-156	1	212	1	212
APS16641.1	8.15e-156	1	212	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A02_A	1.39e-46	30	212	1	166	X-raycrystallographic structure of EfCBM33A [Enterococcus faecalis],4ALC_A X-Ray photoreduction of Polysaccharide monooxigenase CBM33 [Enterococcus faecalis],4ALE_A Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction. [Enterococcus faecalis],4ALQ_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis V583],4ALR_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALS_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALT_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis]
2YOX_A	2.08e-43	30	211	1	177	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	2.15e-43	30	211	1	177	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]
2BEN_A	1.50e-41	30	211	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2BEM_A	2.99e-41	30	211	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	3.89e-47	1	212	1	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	3.67e-35	12	210	17	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q5E183	3.20e-34	14	209	8	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
B5ESR7	3.20e-34	14	209	8	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q87FT0	1.10e-32	17	209	8	199	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999100	0.000169	0.000161	0.000149	0.000135

TMHMM  Annotations     

start	end
5	22