CAZyme Information: MGYG000001695_00731

Basic Information

• Species: Megasphaera massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera massiliensis
• CAZyme ID: MGYG000001695_00731
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		58811.27	9.4069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001695	2661757	Isolate	France	Europe

• Gene Location: Start: 8153; End: 9694 Strand: +

Full Sequence      

METYQTKHETPGMISLVQRLWQRVLSQPAVVLAVMTAILCFAANHLLVVTDPVESNYALT
AKEMLASGDYVSPRIFGNYWYDKPIFFYWELIAAFKLFGISNFAARFFPALFGVAGILLA
YAFTARLYDKKTGFFTGLILLTTVEYFYLSKAIITDMTLFVFYSACLMAFYIAYSEKRPA
FYYAAYAFAGLSVLTKGPIGLLQPGLIILLFLLWRRDLKALLHLKMISGLMLFLAITAIW
YVPMYLVHGSDFISQFIGVHNVLRATVSEHPRYDVWYYYSAIFLVGFIPWVFTLPLAWRD
YGLTRKMAALWKEKKVRLPALSMKTQFLLVWAVTIFVTYQFMATKYMTYTFPYMIPIAIG
FASYLKKYDRFVVNLAGIVLALYVAVTYLVIIPQCQQASAYGVSQIVRTVADDQTTVVMY
GGRYSVSQTYYSGHRAYRLATAERIRELLPGDISWNAKNVMPFMAIEDLADHDKVLALVN
DREEAHFLQEVPGHWKWIGQKGVWVVYQKESDL

Enzyme Prediction     

No EC number prediction in MGYG000001695_00731.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	29	402	1.2e-90	0.6592592592592592

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.99e-40	30	392	11	366	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.42e-23	52	367	31	335	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.42e-16	82	241	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.63e-10	54	248	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.94e-06	77	196	56	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO74995.1	1.46e-293	1	513	1	512
CCC74317.1	1.46e-293	1	513	1	512
ALG42265.1	2.36e-292	14	513	3	502
AVO27725.1	3.43e-292	1	513	1	512
AXL22207.1	1.70e-204	15	510	21	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.10e-23	52	352	57	351	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.26e-23	52	367	28	323	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A4SQX1	9.52e-23	51	363	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.30e-21	51	363	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
Q4K884	8.02e-18	52	363	63	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
O67601	1.24e-17	44	288	20	250	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	50
85	104
111	128
132	154
159	176
191	213
220	242
276	298
327	344
348	365
370	392