CAZyme Information: MGYG000001695_01839

Basic Information

• Species: Megasphaera massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera massiliensis
• CAZyme ID: MGYG000001695_01839
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001695_64|CGC1	42451.56	6.1756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001695	2661757	Isolate	France	Europe

• Gene Location: Start: 38251; End: 39405 Strand: -

Full Sequence      

MKIMFSAGEASGDLHGANLARALKQLAPDIELLGMGGEKMRDAGVDIVYDIDNLGVIGIG
EIIRKIPFFFRLRDFLVDTMKKEKPDVLVCIDYPGFNMRLIKAAKAAGIPVIYYILPTIW
AWHKSRGKTIAKYTDLAISLFPFEAKLYEDIGTNVLYTGHPLLDSVHPSLSRHDAFLKFG
LSEEKRTILLMPGSRVQEVTSLLPCMLEAAKQIERDYGDLQFLIPRATTIDRAMLDDIIA
SSGMTVTVGEGNVYDMMNISTAAIAASGTATLETALMGLPTLLVYRVNRLTYWLSKILVH
IESIGLPNIIMGRRVIPELWQDDVTPDNIADAVLPMLDDGPRRAKLCEDLSAVRRTMGES
GAVMRTAQAVLTFARERGIHEAVQ

Enzyme Prediction     

No EC number prediction in MGYG000001695_01839.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	1.9e-123	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.44e-151	1	378	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.15e-135	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.66e-110	3	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.51e-101	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.75e-64	1	332	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO26605.1	2.72e-224	1	384	1	384
CCC72315.1	5.48e-224	1	384	1	384
AVO73783.1	5.48e-224	1	384	1	384
ALG41186.1	2.23e-223	1	384	1	384
AXB81636.1	2.37e-189	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.59e-63	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.08e-62	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.51e-100	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.20e-97	2	371	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	9.69e-96	3	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	5.48e-95	2	371	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
A9KC41	1.62e-89	3	370	6	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999672	0.000360	0.000009	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001695_01839.