CAZyme Information: MGYG000001696_00296

Basic Information

• Species: Enterococcus_A raffinosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A raffinosus
• CAZyme ID: MGYG000001696_00296
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	MGYG000001696_2|CGC4	21602.53	10.2743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001696	4207346	Isolate	India	Asia

• Gene Location: Start: 105853; End: 106431 Strand: +

Full Sequence      

MRKLSRWLVVFSVLLGMFGFSIKGFAHGYVSSPGSRAYLGTNAGGRLNQNVGRAQWEPQS
IEAKKNTFIEGKIASAGVSGFEPLDDQTISRWHKNTISTGSLTISWYLTAPHRTSFWDYY
ITKPGWNPNNPLKISDFEHIKQIDDHGAVPQKVVNQKITIPSNRKGYNIILAVWNISDTT
NAFYQVIDVNIR

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	27	190	4.4e-49	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	1.18e-64	13	191	10	193	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	3.03e-64	2	191	5	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	7.50e-63	27	190	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	1.72e-54	27	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
PHA03387	gp37	3.99e-05	86	150	130	199	spherodin-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ61591.1	6.52e-134	1	192	1	192
VEF85652.1	4.19e-105	1	192	1	192
QTF90404.1	5.94e-105	1	192	1	192
AOM23146.1	5.94e-105	1	192	1	192
QUR71501.1	5.94e-105	1	192	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A02_A	3.76e-85	27	192	1	166	X-raycrystallographic structure of EfCBM33A [Enterococcus faecalis],4ALC_A X-Ray photoreduction of Polysaccharide monooxigenase CBM33 [Enterococcus faecalis],4ALE_A Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction. [Enterococcus faecalis],4ALQ_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis V583],4ALR_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALS_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALT_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis]
5L2V_A	6.59e-55	27	191	1	164	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]
5LW4_A	3.95e-50	27	191	1	169	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
5WSZ_A	9.52e-48	27	191	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
6T5Z_A	2.05e-45	27	191	1	171	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	1.30e-84	26	192	28	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	6.59e-40	26	190	27	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q6LKG5	8.30e-36	13	189	13	200	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
C3LW75	2.12e-33	1	189	1	199	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=gbpA PE=3 SV=1
Q9KLD5	1.09e-32	1	189	1	199	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000801	0.998325	0.000317	0.000182	0.000177	0.000172

TMHMM  Annotations     

start	end
7	29