CAZyme Information: MGYG000001698_03795

Basic Information

• Species: Marvinbryantia formatexigens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia formatexigens
• CAZyme ID: MGYG000001698_03795
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000001698_28|CGC1	85308.2	5.6454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001698	4516105	Isolate	United States	North America

• Gene Location: Start: 23268; End: 25613 Strand: -

Full Sequence      

MVMTEKKIGELVSMLTLEEKAGLTSGKDNWFTKAVERLGVPQVRTSDGPHGLRTQAGKIN
SLEENASIPAVCFPAACATAASFDRDLLYRMGEALGRECQSTGVHVLLGPGVNIKRSPLC
GRNFEYFSEDPYLAGELGAAFVKGVQSQGVGTSLKHFFANSQEHRRMDASSEMDERTMRE
IYLPAFETVVKQAQPWTVMASYNKIGGVYSTANRKYLTDLLRKEWGFEGVVTSDWGATHD
RPAAVAAGCDLTMPAEDTDHLIVEAVRNGTLSEEALDACCIRLLKLAFRAAEQHRENIAF
DYEGDHALAREIAGQSVVLLKNEDNILPLAEEADVAFIGPFAKEPRYQGGGSSHINSFKV
VGALEAAEHRGVRAQYAAGCRPDGETDELLLAQAIEKAKQAKIAVVFAGLTDGMESEGVD
RRHMRLPEGHNMLIEAVCAANPNTVVVLHNGSPVEMPWVDRPKAILECYLAGQAAGEAVT
DVLYGDVNPSGHLPETFPKRLEDNPSYLYYFGEGGVVNYNEGLFVGYRYYESKKQEVLFP
FGHGLSYTTFRCSDLQLNKKKLTEGEDLTAAVTVTNIGKRAGKAVVQVYVAPEKVEMIRP
VRELKDFVKVKLAPGESKTVTFTLQKRAFAHWNPTVHQWRTESGKYTIQIGENAHDICLE
AEVQMEAEPVPPAGGYHIGIPMGEFAKSPKGRRFLVENIIYMIKGMAAAGFIPKEMAAML
EQLPGGVNLAAIDMLAQRAGNAAGGTGGVQVLLGQPLGMLDGFLPQEKQEELHKLLAELN
Q

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	254	1.9e-72	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.88e-115	37	651	101	751	beta-glucosidase BglX.
COG1472	BglX	6.54e-79	2	366	1	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	9.01e-73	317	527	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	5.21e-63	11	624	56	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.48e-45	3	286	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO47639.1	0.0	8	780	3	753
QTL78999.1	8.38e-315	10	780	14	798
AHF25022.1	4.67e-288	8	667	10	672
QTE69612.1	2.96e-287	8	667	3	665
QNO18561.1	7.33e-284	8	663	3	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.09e-246	8	667	5	670	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.28e-201	12	714	9	705	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	7.72e-131	3	668	1	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	3.62e-129	6	668	2	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.51e-128	6	668	2	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	6.00e-246	8	667	5	670	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.92e-198	12	714	9	714	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.94e-196	12	668	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BB53	3.08e-149	3	666	1	831	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
Q0CAF5	3.67e-147	3	657	1	823	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001698_03795.