CAZyme Information: MGYG000001700_00882

Basic Information

• Species: Citrobacter_A sedlakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sedlakii
• CAZyme ID: MGYG000001700_00882
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000001700_2|CGC1	16766.32	9.1468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001700	4631466	Isolate	not provided	not provided

• Gene Location: Start: 21696; End: 22136 Strand: -

Full Sequence      

MKRIIFLLLIVSQSVFANCWDNAAHYYHVDPYLLYAIAKVESGMNPYAVGVNHDGTRDVG
LMQINSSHFTELQRHGIDEYRLIAEPCTSIMVGASILSDMIKVYGNNWEAVGAYNAGLKK
ENYPQRMIYARKVWNKYQQLKKPYRG

Enzyme Prediction     

No EC number prediction in MGYG000001700_00882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	25	141	4.3e-25	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	4.34e-88	1	143	1	145	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	5.42e-53	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	3.07e-29	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	5.98e-25	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	1.48e-17	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC28639.1	7.64e-106	1	146	1	146
AUJ82265.1	2.83e-88	1	141	1	141
QGG08828.1	2.83e-88	1	141	1	141
CAD5354163.1	4.01e-88	1	141	1	141
QBC03532.1	5.33e-88	1	141	1	141

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.70e-11	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	9.24e-44	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	9.24e-44	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.31e-43	4	141	6	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	2.54e-34	1	137	1	138	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	1.02e-33	1	137	1	138	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001648	0.991524	0.006125	0.000237	0.000219	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001700_00882.