CAZyme Information: MGYG000001700_01212

Basic Information

• Species: Citrobacter_A sedlakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sedlakii
• CAZyme ID: MGYG000001700_01212
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	MGYG000001700_2|CGC7	61596.46	6.6167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001700	4631466	Isolate	not provided	not provided

• Gene Location: Start: 365881; End: 367557 Strand: +

Full Sequence      

MHFDYIIIGAGSAGNVLATRLTEDSNTTVLLLEAGGPDYRTDFRTQMPAALAYPLQGKRY
NWAYETEPEPHMNYRRMECGRGKGLGGSSLINGMCYVRGNAMDLDNWANEPGLEHWSYLH
CLPYYRKAESRDIGANAYHGGDGPVCVTTSKPHVNPLFDAMIEAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPQGRRASTARGYLDQARKRPNLTIITHALTDHIIFDGKKAVGVEWLEG
DGTIPTTATAEKEVLLCAGAIASPQILQRSGVGDAALLKAFAIPLVHHLPGVGENLQDHL
EMYLQYACKKPISLYPALQWWNQPKIGAEWLFGGTGIGASNHFEAGGFIRSRDAFTWPNI
QYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVHLKSRDPREHPAILFNYMSTDQD
WQEFRDAIRITREIINQPALDPFRGREISPGSDCQSDEQLDAFVREHAETAFHPCGTCKM
GFDEMAVVDGEGRVHGVENLRVVDASIMPQIITGNLNATTIMIGEKLADAIRGRAPLAKS
TASYYVAGDTPVRQAPRR

Enzyme Prediction     

No EC number prediction in MGYG000001700_01212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	532	2e-162	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	1	538	6	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
PRK02106	PRK02106	0.0	1	558	4	558	choline dehydrogenase; Validated
TIGR01810	betA	0.0	4	537	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
pfam00732	GMC_oxred_N	1.43e-70	73	301	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
pfam05199	GMC_oxred_C	8.88e-47	393	527	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB3230510.1	2.36e-190	5	546	27	570
AWP09430.1	5.56e-185	3	545	20	564
ANI26486.1	8.65e-184	3	545	71	615
CAG5089487.1	3.42e-156	3	537	17	564
CAG5086058.1	6.45e-155	3	547	15	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	8.42e-83	3	532	14	527	ChainA, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.26e-82	3	532	14	527	Crystalstructure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.26e-82	3	532	14	527	Crystalstructure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
6ZH7_A	8.53e-79	3	543	8	572	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	8.53e-79	3	543	8	572	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7MCD0	0.0	1	553	1	553	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=betA PE=3 SV=1
P17444	0.0	1	553	1	553	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=betA PE=1 SV=1
B7UJG4	0.0	1	553	1	553	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=betA PE=3 SV=1
B7N8L3	0.0	1	553	1	553	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=betA PE=3 SV=1
Q0T7N0	0.0	1	553	1	553	Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000017	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001700_01212.