CAZyme Information: MGYG000001700_01960

Basic Information

• Species: Citrobacter_A sedlakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sedlakii
• CAZyme ID: MGYG000001700_01960
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		46031.57	8.4979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001700	4631466	Isolate	not provided	not provided

• Gene Location: Start: 29964; End: 31217 Strand: +

Full Sequence      

MKRLPLLAALPLLCASVASASSMMSVGYFNGGGDVTAGPGGDINKLDVRQITHLNYSFGL
IYNGEKEETNVALKDPAMRHQIWLSPKVQSDLAQLPVLRKQNPNLKVLLSVGGWGARGFS
GAAATPETRAVFIQSAQEIVKKYGLDGIDLDWEYPVNGAWGLVESQPADRDNFTLLLKEL
RQAFGKAKLVTIAVGANAESPKSWVDVKAIAPLLDYINLMTYDMAYGTQYFNANLYDSKA
WPTVAAADKYSVDFVVNNYLAAGLKPQQMNLGIGFYGRVPKRSVEPGIDWSKPDAQKNPV
TQPYFGEQEVALFRSLGIDLKKDTYVKYNDIVKTFLNDPQKRFTRHWDDDAKVPWLSVKS
AEGKTLFALSYEDPRSVAIKADYIKKRGLAGAMFWEYGADDNNQLAKQLAESLAITP

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	25	408	1e-74	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	5.29e-105	27	400	3	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	8.49e-83	27	400	4	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	2.29e-72	52	401	29	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
pfam00704	Glyco_hydro_18	1.83e-71	27	400	4	307	Glycosyl hydrolases family 18.
COG3325	ChiA	2.84e-65	45	417	59	440	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC28368.1	3.35e-308	1	417	1	417
QBY27881.1	2.55e-287	1	417	1	417
CBG88041.1	2.55e-287	1	417	1	417
AMG94376.1	1.41e-284	1	416	1	416
AUO64755.1	2.00e-284	1	416	1	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QOK_A	4.57e-260	2	415	5	418	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4LGX_A	1.62e-238	15	415	1	401	Structureof Chitinase D from Serratia proteamaculans revealed an unusually constrained substrate binding site [Serratia proteamaculans 568]
6F8N_A	4.40e-238	15	415	3	403	Keyresidues affecting transglycosylation activity in family 18 chitinases - Insights into donor and acceptor subsites [Serratia proteamaculans 568],6F8N_B Key residues affecting transglycosylation activity in family 18 chitinases - Insights into donor and acceptor subsites [Serratia proteamaculans 568]
4NZC_A	6.98e-238	18	415	1	398	Crystalstructure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]
4PTM_A	8.39e-238	18	415	1	398	CrystalStructure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine, a hydrolyzed product of hexasaccharide at 1.7 Angstrom resolution [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.57e-52	15	413	36	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W092	5.00e-38	43	401	62	390	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
Q95M17	2.14e-32	44	401	44	366	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
G5EAZ3	9.62e-32	46	416	25	363	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
Q92222	9.62e-32	46	416	25	363	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.999047	0.000181	0.000155	0.000154	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001700_01960.