CAZyme Information: MGYG000001700_03044

Basic Information

• Species: Citrobacter_A sedlakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sedlakii
• CAZyme ID: MGYG000001700_03044
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000001700_10|CGC5	73756.53	9.0488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001700	4631466	Isolate	not provided	not provided

• Gene Location: Start: 236116; End: 238053 Strand: -

Full Sequence      

MDKAKSFTWRFIAASVCLLAVSQAARADSLDEQRIRYAQIKQAWDNRQMDVVEQMMPGLK
NYPLYPYLEYRQITDDLMNQPTITVTRFVRANPTLPPARTLQSRFVNELARREDWRGLLA
FSPDKPRTTEAQCNYYYARWSTGQTEEAWQGAKELWLTGKSQPNACDKLFSVWRASGTQD
PLAYLERIRLAMKAGNTGLVTVLAGQMPADYQTIASSIISLANDPNTVLTFARTTGATDF
TRQMAAVAFASVARQDAENARLMIPSLAQAQQLNEAQTQELRDIVAWRLMGNDVTDEQAK
WRDDAIMRSQSTTLVERRVRMALGIGDRRGLNTWLARLPMDAKEKDEWRYWQADLLLERG
REAEAKEILHALMQQRGFYPMVAAQRLGEEYVLKIDKAPANVDNDLTRGPEMARVRELMY
WNLDNTARSEWANLVTSRSKTEQAQLARYAFNNHWWDLSVQATIAGKLWDHLEERFPLAY
NDLFARYTRGKDIPQSYAMAIARQESAWNPKVKSPVGASGLMQIMPGTATHTVKMFSIPG
YNSQSQLLEPETNINIGTHYLQYVYEQFGNNRIFASAAYNAGPGRVRTWLGNSAGRIDAV
AFVESIPFSETRGYVKNVLAYDAYYRHFMGQKETLMSDSEWQRRY

Enzyme Prediction     

No EC number prediction in MGYG000001700_03044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	497	622	7.3e-31	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	645	1	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	6.67e-68	475	627	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	7.38e-54	346	634	1	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	3.97e-43	477	621	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.00e-37	484	600	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC29470.1	0.0	1	645	1	645
QZE45594.1	0.0	1	645	1	645
AST78376.1	0.0	1	645	1	645
SBA05338.1	0.0	1	645	1	645
AMG55649.1	0.0	1	645	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	0.0	28	645	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	0.0	28	645	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5OHU_A	2.90e-88	11	645	6	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	3.35e-85	32	645	1	610	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	5.96e-85	33	645	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	6.40e-72	272	640	227	587	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39433	5.03e-19	604	645	1	42	Soluble lytic murein transglycosylase (Fragment) OS=Enterobacter cloacae OX=550 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000374	0.998840	0.000266	0.000172	0.000167	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001700_03044.