CAZyme Information: MGYG000001701_02044

Basic Information

• Species: Corynebacterium afermentans
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium afermentans
• CAZyme ID: MGYG000001701_02044
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44705.77	6.5978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001701	2240769	Isolate	France	Europe

• Gene Location: Start: 13752; End: 14948 Strand: -

Full Sequence      

MPETWAHRADLAESAVNERHAQKLWGLPKTNLAVVTWPPGPKDRLFWHWHYWWQAQYLDC
QVDAATRRETKTRRRRIADTLRGVQRRNRGKLLTNVHYDDKAWLALAWNRATRIGGIKRN
RHLDDLEFDLLAGIDPVTGVLPWRSGETFYNVPSNATAALLFARTGRLDKAREIVDWIFD
NLVREDGLLDDGIRMRMSGPEVVDKIYTYNQGTALGASLEIALALREDVGLAYNEQIDSF
VYSERADASMFYITHIRAIVQSVALNLATPQGVLLSPPEESGEGDGGLFKGILARYLAEV
AMRLPEDSKENIATRKIAARLVMQSADSLWSHRLEVDGLPVFAAEWTQDAKLPHNYGLGP
SSISEAVGLVRIDERDLSVQLSGWMLLEAAARVAAAQA

Enzyme Prediction     

No EC number prediction in MGYG000001701_02044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	352	1.3e-66	0.8519553072625698

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	2.17e-131	8	388	2	365	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.72e-12	99	306	109	297	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIL97573.1	5.82e-272	1	397	1	397
QNP90021.1	2.95e-255	1	398	1	404
AQQ16150.1	9.55e-241	1	396	1	396
QQU84296.1	7.40e-236	1	395	1	395
AKV59622.1	2.12e-235	1	395	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	7.55e-22	48	391	85	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.62e-20	48	391	86	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.00e-19	48	391	86	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	6.40e-18	5	300	3	278	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001701_02044.