CAZyme Information: MGYG000001702_02264

Basic Information

• Species: Virgibacillus picturae
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus picturae
• CAZyme ID: MGYG000001702_02264
• CAZy Family: CBM50
• CAZyme Description: Sporulation-specific N-acetylmuramoyl-L-alanine amidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000001702_2|CGC2	28221.57	8.2844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001702	3675175	Isolate	Saudi Arabia	Asia

• Gene Location: Start: 14387; End: 15166 Strand: +

Full Sequence      

MAIIAIGAGHGINTPGKRTPAGEREWSFNNKVVSAAINYLGGYENATIVRLDDPTGNTDV
PLTTRTNKANNANADILVSYHHNANTGQWGTWTGTETYHYPGSSSGNTLARAIHPSIVTA
MGLRDRGVKSANFHMVRESNMPAILIEGGFMDSTIDIVKMRNNGVMDNTGKALADSIASY
LGLVKKDGGGTGQGYVEIVTDSLWTYNTADWNDRAVVVNRGEVFTVIRDRFPVDGGYMYQ
IKSGLYITANPNYVRYYTR

Enzyme Prediction     

No EC number prediction in MGYG000001702_02264.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02696	MurNAc-LAA	4.55e-42	3	178	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	1.13e-36	4	177	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
COG0860	AmiC	1.05e-29	1	183	42	230	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
smart00646	Ami_3	1.33e-25	66	177	1	113	Ami_3 domain.
pfam19087	DUF5776	1.95e-04	198	254	10	67	Domain of unknown function (DUF5776). Presumed stalk domain found in bacterial surface proteins forming tandem repeats with high sequence identity. This domain is also associated with other known bacterial surface protein stalks and adhesive domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUJ24216.1	2.60e-124	1	259	1	306
AEO93293.1	1.38e-81	1	186	1	186
AEO93294.1	8.70e-78	1	186	1	186
QNK87731.1	1.79e-58	4	189	163	350
AMQ06718.1	7.22e-58	1	189	161	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RN7_A	1.90e-20	4	181	6	182	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
1JWQ_A	6.17e-17	1	181	1	176	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
5EMI_A	8.02e-09	60	181	60	178	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
5J72_A	2.21e-06	4	161	454	617	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O48471	5.88e-29	3	254	4	266	Endolysin OS=Bacillus phage SPP1 OX=10724 GN=25 PE=4 SV=1
P37134	1.01e-21	1	185	1	179	N-acetylmuramoyl-L-alanine amidase CwlM OS=Bacillus licheniformis OX=1402 GN=cwlM PE=3 SV=1
Q06320	5.47e-20	1	190	1	184	Sporulation-specific N-acetylmuramoyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlC PE=1 SV=1
Q02114	1.45e-14	55	180	369	494	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P54525	1.63e-10	65	180	89	203	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.969548	0.030062	0.000234	0.000076	0.000035	0.000075

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001702_02264.