CAZyme Information: MGYG000001702_03456

Basic Information

• Species: Virgibacillus picturae
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Virgibacillus; Virgibacillus picturae
• CAZyme ID: MGYG000001702_03456
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000001702_4|CGC2	81475.07	9.6003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001702	3675175	Isolate	Saudi Arabia	Asia

• Gene Location: Start: 30792; End: 32852 Strand: -

Full Sequence      

MEIGIKDILVKNNIYLIKISVDKQLAEETEDWSIILKSRDRTKKILLTSSYVVNDYIEIS
IPYLELESKLIEQDIWDLFLFHEKSEESEKIIRIKGGNKDYYSFTETLINRNKIIQPYET
KNGNFSIKLMDYKVFSKIESCNFKRGNLNFSGYFDFPPLYRTDSYSIEAAKLYVAVPKDE
KSEEISLKLVEREQRGGRKCYEIEGKIDLKKYLLSQKTLQLLLVVEFKKADGTIEEYTDK
VKIMGNKKKLPSAIIFNEGRKYKVSIKKLNDFTIGISHYNFKQMIINKIKNKWTKLRRGE
KLKALYKLCFKLLGKLPVKKDLIVFESFLGKQYSDSPRAIFEYMQENKLNNHMYWSFDRR
NIEKFDERSGVKAIKRFSLRWLYLMARANYWVTNSRLPLWIPKPSHTIYVQTWHGTPLKR
LAADMDQVKMPGTNTKKYKRNFLKEASKWDYLISPNEYSTEIFKRAFNFDGKILESGYPR
NDFLINSNNEEMKKNIKEEAQLPLNKKVILYAPTWRDNQFYGKGKYKFDLNMDFSKLKKE
LGEEYIIILRLHYLVAENLDLSEYKGFIFDLSNHEDIRELYLISDILITDYSSVFFDYAN
LKRPMIFYVYDLEDYRDNLRGFYFDFETRAPGPLLKSTTQVIQEVKRLENTNLTLTDNAQ
EFYGKFCYLEDGKATERVVTEIFRKD

Enzyme Prediction     

No EC number prediction in MGYG000001702_03456.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.32e-144	317	683	1	359	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	4.78e-106	300	686	6	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN00810.1	5.20e-144	242	685	311	740
QHS23522.1	4.18e-141	315	682	343	708
ALQ70765.1	4.49e-138	313	684	341	711
AJG93766.1	8.92e-138	313	685	341	712
AKG72826.1	2.16e-137	223	685	258	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.91e-119	296	686	331	717	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.06e-118	296	686	331	717	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	5.72e-118	296	686	331	717	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	2.27e-182	11	686	40	746	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	6.47e-166	305	682	16	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	1.97e-120	310	684	18	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	8.46e-119	296	686	331	717	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	4.94e-36	304	682	241	603	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001702_03456.