CAZyme Information: MGYG000001703_02642

Basic Information

• Species: Vibrio fluvialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio fluvialis
• CAZyme ID: MGYG000001703_02642
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000001703_9|CGC5	23205.16	7.7544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001703	4750671	Isolate	Bangladesh	Asia

• Gene Location: Start: 232563; End: 233165 Strand: -

Full Sequence      

MAVAKWLSVSTLLLLAGCATSPPSKQNNLCEIFREKPQWYEDAVEMQDEWGTPIQIAMAI
IKQESSFRHDAKPPKDYLLGFIPWGRVSSAYGYAQAQDPAWDDFLRATDYGGSRTNFDDS
LMFIGWYTSETQKTLGVSKWDTYHQYLAYHEGRGGFKRKSYQSKPTLIKVARKVEQQAKD
YGWQLKQCRQELEDNRSWFF

Enzyme Prediction     

No EC number prediction in MGYG000001703_02642.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4764	COG4764	9.28e-77	3	191	5	197	Uncharacterized protein [Function unknown].
cd00442	Lyz-like	0.002	56	127	1	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMF95320.1	4.95e-151	1	200	1	200
QUF69291.1	2.36e-149	1	200	1	200
QTG91633.1	2.45e-149	4	200	5	201
QTH04426.1	2.01e-148	4	200	5	201
QTH08434.1	8.19e-148	4	200	5	201

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001703_02642.