CAZyme Information: MGYG000001703_03438

Basic Information

• Species: Vibrio fluvialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio fluvialis
• CAZyme ID: MGYG000001703_03438
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		39514.25	8.2469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001703	4750671	Isolate	Bangladesh	Asia

• Gene Location: Start: 50827; End: 51852 Strand: -

Full Sequence      

MVNKMKTTISICIPSYNRPQELARLLDSIDSNYSENIEVLICEDKSPKRDEIKSVANSYK
ERTKYKVVYHENETNLGYDNNIKNLVKRASNDFIIFMGDDDVFIPGGLDKMMSFLNENSS
LGYILKSHQHRFKNDNVEKFRYFDGTKIFVKGQETYVKLFRRSVFISGFTINRHYVKDLI
IDDFDGGLLYQLYLLAEVSINYDCAYFDEPLTMAFEEGIPYFGTSESEKGRYTPGTITVE
NSLNFLKGFFDITRYIDKKYNLNSTSLVKKDMSKYFYPSLAIQRDKGVKVFLSYVSKLNG
MGFNCSIYYYIYVVALTIFGKNICDRIVSELKNVLGKTPQL

Enzyme Prediction     

No EC number prediction in MGYG000001703_03438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	142	1.9e-22	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.22e-17	10	165	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.04e-14	11	145	1	132	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	4.20e-13	5	276	1	268	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	7.84e-10	10	113	1	102	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04184	GT2_RfbC_Mx_like	3.45e-09	9	144	3	148	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMF95571.2	2.74e-247	1	341	6	346
ATH06700.1	5.39e-143	8	341	5	337
VEJ19450.1	1.99e-121	10	341	7	338
SMD28990.1	1.99e-121	10	341	7	338
VEI54093.1	3.04e-113	6	341	3	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48214	4.96e-10	9	124	2	110	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
P26401	8.49e-10	9	121	3	115	Abequosyltransferase RfbV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbV PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001703_03438.