CAZyme Information: MGYG000001703_03457

Basic Information

• Species: Vibrio fluvialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio fluvialis
• CAZyme ID: MGYG000001703_03457
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41356.54	6.9073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001703	4750671	Isolate	Bangladesh	Asia

• Gene Location: Start: 72044; End: 73123 Strand: +

Full Sequence      

MNIKFLIRDLKIEGVQVVTVRLARLLQANGHNVQIITLFDHIELPELSDLNISCLNIPQN
NKCERVLLSHFKSWYQDAEFDYLIAPHSECIKLIAHFSDQRLVPFIHNSDQYSYSQRNCF
KRFRYRNRLAKRLKGKHVLCVSESIKKFTEQCCGKHIQPASVLYNPFDIETIRHYACDES
AQASQENYLLFVGRLEKQKRVDRLLTSFSYVKNPSIKLVILGEGSLEQKLKIQAEELNLG
ERVEFKKFDTNPYPIIKGAKAVVLTSDHEGLPTVIIEALILGIPALSVNCPSGPDEILTG
ELSKYLIHSYDEKVIAERIDALLEDRDIPDLSAGYEKFTEEKVYQSFMTIVEQWNNDKH

Enzyme Prediction     

No EC number prediction in MGYG000001703_03457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	182	327	1.3e-29	0.925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	1.22e-65	2	333	1	336	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	3.53e-46	3	356	2	351	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03801	GT4_PimA-like	7.51e-41	14	352	15	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	9.54e-33	186	330	2	149	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	8.99e-30	1	352	1	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMF95589.1	2.15e-261	1	359	1	359
AVH31569.1	2.58e-253	1	359	1	359
QUF68987.1	4.26e-220	1	359	1	359
QDC91867.1	3.41e-203	1	359	1	359
QXO17262.1	1.77e-134	1	348	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N7Z_A	1.62e-14	139	302	138	305	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	1.63e-14	139	302	139	306	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	1.64e-14	139	302	140	307	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4X7M_A	2.67e-14	163	356	290	489	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X6L_A	2.67e-14	163	356	290	489	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58459	6.68e-17	192	352	208	403	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q0P9C7	5.64e-16	162	325	172	332	N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglJ PE=1 SV=1
P27127	9.86e-16	139	351	136	351	Lipopolysaccharide 1,6-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaB PE=3 SV=2
Q06994	8.89e-14	139	302	138	305	Lipopolysaccharide 1,6-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaB PE=1 SV=2
A0A0H2WWV6	1.46e-13	163	356	290	489	Poly(ribitol-phosphate) alpha-N-acetylglucosaminyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=tarM PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001703_03457.