CAZyme Information: MGYG000001703_04389

Basic Information

• Species: Vibrio fluvialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio fluvialis
• CAZyme ID: MGYG000001703_04389
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		25966.23	10.2261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001703	4750671	Isolate	Bangladesh	Asia

• Gene Location: Start: 11577; End: 12263 Strand: -

Full Sequence      

MRGVRHRIKRLLMTAIVLALGLPVVLVLVLKYVNPPFWGWQVSRTLFPPQGYPQQSQHQW
IPLASASPSLPLAVMASEDQRFPEHWGVDVNALASVIRNRGENGPDRGASTITQQTAKNV
FLFPSHTYIRKAYELYISLLLELIWGKERIMEMYLNVVEFGPGIYGIQAASEHYFGVSAN
RLTRYQAAQLAVVLPNPYRIQPYPMTHYVQQRVNWVLRQMQNLGAVAL

Enzyme Prediction     

No EC number prediction in MGYG000001703_04389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	221	2.1e-55	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	4.30e-101	1	228	1	231	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	1.17e-68	57	221	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.04e-65	50	226	68	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02070	mono_pep_trsgly	3.39e-64	57	224	54	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02074	PBP_1a_fam	2.54e-47	59	226	3	171	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKE36452.1	8.07e-164	1	228	1	228
QTH11578.1	8.07e-164	1	228	1	228
AMF93404.2	8.07e-164	1	228	1	228
QTG94723.1	4.67e-163	1	228	1	228
AVH34618.1	1.90e-162	1	228	1	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.06e-23	73	226	35	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.49e-23	73	226	35	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	8.52e-21	73	226	54	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	2.16e-20	61	217	43	200	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	4.95e-20	57	217	26	187	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87FR1	3.06e-97	7	228	4	225	Biosynthetic peptidoglycan transglycosylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=mtgA PE=3 SV=1
Q8EB02	5.90e-70	1	228	1	226	Biosynthetic peptidoglycan transglycosylase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mtgA PE=3 SV=2
A0KK53	3.60e-69	24	228	25	228	Biosynthetic peptidoglycan transglycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mtgA PE=3 SV=1
A1S3J2	8.48e-65	2	228	20	241	Biosynthetic peptidoglycan transglycosylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mtgA PE=3 SV=1
A6VRW7	2.04e-58	57	224	49	216	Biosynthetic peptidoglycan transglycosylase OS=Marinomonas sp. (strain MWYL1) OX=400668 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34