CAZyme Information: MGYG000001704_00969

Basic Information

• Species: Blautia hansenii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hansenii
• CAZyme ID: MGYG000001704_00969
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1823		203798.28	4.5087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001704	3065949	Isolate	not provided	not provided

• Gene Location: Start: 992097; End: 997568 Strand: +

Full Sequence      

MKRWKQVCSTMLAGTMLFQTPVAAAPKEEKEEKSPWVSDWKPEDGTTTGDAYQIYPVPQK
IEYPSKTEFDMDKNVGVVSGEKVDKATNDYLNEVLEEFDRTPKKEKKAGDGSDIIIGVKG
SGDEADKYFADKKLDENLFEQSGGYALSADGEDIVILGKDTEAAFYGVATLKMMFSSFNG
EKFYPVEIQDYASIDARGYIEGFYGSWTHEQRKSLMEFTRDVKMNLYVYASKTDAYHTSK
WAELYPDDMLNQFKELVKLQEKNKTEFSWAVHIGDMLKGVQPNASVQYDENKYQESKKKL
MAKFDQLYNIGVRRFCLLNDDFGAGSPELVVRLVNDLNKEYIKAKGCKPIIYCPQGYNVA
WSQGANGQKELETLKQFDKDVLIFWTGQDVNSPFTQESINYAKEKTGHSPVFWVNYPCNE
HAKSGIFLGSSAHYIRDNITGLAGAVSNPIHFAEADKVALFQLASYFWNVNDYSQHTEEV
WEQCFKYLEPEVYDAYLTIARNVSNCPGSGRVPEGFEESLYLADTLDAIKKAVEGNTFTA
DMQEVKDLKAEFAHILSAIKTFKEECTNKALVQELTNPGNRENGEGWLQALENVVKAGQY
ILQAQEEMAKAEPDMGIVWQNFSDASAEMDVYNKRTYEFPAGGTQSVKAGSRRLVPFVNA
CMEDVKAVVDELLATGNAETPADRIYTNVSKYAKTPLTIDEKEYGVRNVKVTLEKDQYIG
IKTKEIAETSKVILESSDVSGLTLEYALYGDDWKEVEPGDLQKNIEARYLRLVNKGEKPV
TAMVKKLAAVIENRAVSMSVKGTNIKELQSGSWDMMLDGNAETFALTKGAQKKGDYITVD
LGRTQAINDITFHTADGDQKIYDAKVSVSKNNKDFEEVATWNSESGKVDPPRREYKADAK
GKEGRYVRLQVTKDNNNPLKIFEVEVNKGQKAPGTISPDFALTSDEKADKKALTDKNLAT
VFQISQTDDKSYLEYRITDNVNLDSFTVLQAGSCEAKVILKTADGKEKDLGKLTKTTQEF
KGWEENVHAIRFEFPKGKDVKLNEIILKYGENPSGDVGQAVENIPVDPGVEDSKETVNLA
LNQPVEVSGIETNNVKPESAVDGDENTKWDSAALKGSGAKSPQWIIVDLGTYTNMISEIK
MSYFNKVYPTDYDVQVANDKENWVTVKTIKKENNGPTNPVDTVKEELTQPVATRYVRILF
RSINANAAGNCIGLKELTVNGVRRHVPVSYTSVAELENVNAEVNAENVALPAMVETTIKA
GEEKEQPLKVLPTWDTEKIDTSKPADILVKGALPINYSLVNPEALEAQVHVIVGEGGTEP
ENPERTNLALNQKVEVSDVETDFDGSKTDYEGEYAVDGKADTRWSSGPLNSKLGLGGEPK
DQYIIVDLGAGKNTIDEIKVSYFKKVWPTNYTVEVSADKNTWETVKTIERNSSNDLNVVD
DFKLEEVKNARYVRLSFPKDGLNTNAAGSSVSITELEVYGTKENVELDTTALEQQIAATE
EIIKNAEAEPNKYDSATVEALKTALEAAKAVVNKPESQEQLDKAVEDLKAAQAGLKELNL
DELKAALQKAEEILTEENCYTPESYEAFKAVYEKVKALLGKPMTQQQADDAKAELEAAQG
QLEKVGKEGWVQTENGWEYYENGQKVTGWLYTGNHWYYMNDNGIMVTGWAAVDGHWYYMD
QWGAMCTGWVAADGHWYYMDQWGAMCTGWVAVDGHWYYMDQWGAMCIGWVLVGDTWYYMN
GSGAMCTGWVAADGHWYYMDQWGAMCTGWVVVDGHWYYMDQWGAMRTGWALVGDDWYYLN
ADGTMASNQWIGGYYVDASGKMV

Enzyme Prediction     

No EC number prediction in MGYG000001704_00969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	197	499	6.2e-75	0.9898305084745763
CBM32	1346	1476	2.6e-21	0.8790322580645161
CBM32	1093	1207	5.8e-21	0.7983870967741935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	2.14e-99	197	499	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
NF033930	pneumo_PspA	1.08e-69	1444	1820	249	640	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	5.11e-61	1518	1823	348	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	1.05e-41	1684	1823	507	647	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
COG5263	COG5263	3.50e-40	1628	1823	134	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68920.1	0.0	1	1662	6	1667
AIY84741.1	1.80e-131	47	1046	40	1165
QCJ44358.1	4.78e-112	52	1045	38	1033
APC49528.1	1.58e-109	83	1054	6	1099
ASK62202.1	2.59e-108	37	1046	28	1153

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	7.46e-85	47	658	29	617	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	1.45e-76	44	673	25	652	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PV5_A	3.07e-59	54	575	42	554	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2VVN_A	6.09e-56	46	794	18	737	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	9.47e-56	54	794	16	727	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	3.72e-75	44	852	32	866	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	3.33e-55	46	794	18	737	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	6.78e-49	45	811	32	790	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	3.63e-48	45	571	32	548	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q2CEE3	1.48e-16	198	466	4	272	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007035	0.984410	0.007076	0.000718	0.000398	0.000331

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001704_00969.