CAZyme Information: MGYG000001704_02209

Basic Information

• Species: Blautia hansenii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hansenii
• CAZyme ID: MGYG000001704_02209
• CAZy Family: GH3
• CAZyme Description: Exo-alpha-(1->6)-L-arabinopyranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
121		13484.44	8.8535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001704	3065949	Isolate	not provided	not provided

• Gene Location: Start: 2190050; End: 2190415 Strand: -

Full Sequence      

MNVHRNPLCGRNFEYYSEDPLVSGKMAAAITRGVQSKEGVGTTIKHFACNSQEDNRMGSN
SILSERTLREIYLRGFEIAVKTSQPMAIMTSYNLINGVHAANCKDICTVAARKEWISRIS
L

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	115	5.8e-37	0.5185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.71e-11	3	115	129	245	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.46e-09	1	115	158	288	Probable beta-xylosidase; Provisional
PRK15098	PRK15098	3.25e-05	2	115	160	278	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ93533.1	5.63e-60	1	115	648	762
ANU75960.1	5.63e-60	1	115	648	762
QJU13871.1	5.63e-60	1	115	648	762
ASU28771.1	5.63e-60	1	115	648	762
QMW78964.1	1.08e-59	1	115	648	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X42_A	1.52e-41	1	115	120	233	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	1.52e-41	1	115	120	233	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	6.33e-35	1	115	625	738	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5WAB_A	9.84e-34	1	115	110	223	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	3.43e-33	2	116	110	223	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	1.52e-35	1	115	647	760	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	3.46e-34	1	115	574	687	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P14002	1.88e-32	2	116	110	223	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	4.92e-32	3	115	110	221	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P07337	9.15e-32	2	115	104	216	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001704_02209.