CAZyme Information: MGYG000001705_01564

Basic Information

• Species: Citrobacter portucalensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter portucalensis
• CAZyme ID: MGYG000001705_01564
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653	MGYG000001705_1|CGC22	74528.83	5.7672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001705	4942442	Isolate	not provided	not provided

• Gene Location: Start: 1645633; End: 1647594 Strand: -

Full Sequence      

MMQSDVIEADLNNITITDPFLGEYQRLIRDVVIPYQWQALNDEIPEAEPSHALMNYRIAA
GLEHGEFYGMVFQDSDVTKWLEAVAWSLSQKPDAQLEKTADEVIELLAKAQCEDGYLNTW
YTVKEPGLRWTNVAECHEMYCAGHLFEAAVAFFNATGKRRLLEIACRFADHIDTVFGPNE
GQLRGYPGHPEIELALMRLYEVTQEPRYQALARFFLEERGQQPYYYDIEFAKRGGTWHWD
NWGEAWMVKDKAYTHAHKPLAQQSEAVGHAVRSVYLMTGLAHIARMTNDEEKRQTCLRIW
NNMVQRRMYITGGIGSQGIGEAFTSDYDLPNDTAYGESCASIGLMMFARRMLEMEGDAHY
ADVMERAFYNTVLGGMALDGKHFFYVNPLETQPKSIPHNHIYDHIKPVRQRWFGCACCPP
NIARTLVAIGHYIFTPRPDALFINFYAGTEAQFTVDAQTLALKIEGNYPWDEQVSIRFNQ
PQVVEYTLALRLPEWCAAPTVQVNGEAAQGKMVKGYLHLHRLWQEGDIITLNLPMPVRRV
YANPQVRHAAGKVAIQRGPLVYCLEEADNGAQLHNLSLPKVSAFREIQGVGMLKGKVLLQ
AEGVRVLSAHEDKPLYNFDNRQTALVKQTLTFIPWFSWANRGEGEMRIWVDEV

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	14	563	1.4e-230	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	11	652	9	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	5.44e-173	13	563	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	0.002	148	314	94	289	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC43633.1	0.0	1	653	1	653
APR32648.1	0.0	1	652	1	652
ATX03929.1	0.0	1	653	1	653
AUT96254.1	0.0	1	653	1	653
BBQ82938.1	0.0	1	652	1	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.60e-248	7	652	9	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.43e-241	7	652	9	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	5.40e-163	13	648	2	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	7.61e-163	13	648	2	654	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	2.15e-162	13	648	2	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.96e-162	13	648	2	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001705_01564.