CAZyme Information: MGYG000001705_01727

Basic Information

• Species: Citrobacter portucalensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter portucalensis
• CAZyme ID: MGYG000001705_01727
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000001705_1|CGC24	83412.91	5.9166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001705	4942442	Isolate	not provided	not provided

• Gene Location: Start: 1829420; End: 1831717 Strand: +

Full Sequence      

MKWLCSVGVAVSLALQPALADTLFGNHPLTPEARDAFVTDLLKQMTVDEKIGQLRLISVG
PDNPKEAIREMIKDGQVGAIFNTVTRQDIRKMQDQVMELSRLKIPLFFAYDVLHGQRTVF
PISLGLASSFNLDAVRTVGRISAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYL
TATMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPY
KAGLDAGSGAVMVGLNSLNGTPATSDAWLLKDVLRDEWGFKGITVSDHGAIKELIKHGTA
SDPEDAVRVAIKSGINMSMSDEYYSKYLPGLIKSGKVTMAELDDAARHVLNVKYDMGLFN
DPYSHLGAKESDPQDTNAESRLHRKEAREVARESLVLLKNRLETLPLKKSATVAVVGPLA
DSKRDVMGSWSAAGVADQSVTVLTGIKNAVGDQGKVLYAKGANITNDKGIVDFLNLYEEA
VKVDPRSPQAMIDEAVNAAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKA
TGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFP
RSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGPLYPFGYGLSYTTFTVSDVKLSS
PTMKRDGTVTASVQVTNTGKREGATVIQMYLQDVTASMSRPVKQLKGFEKVNLKPGETQT
VSFPIDIEALKFWNQQMKYDAEPGKFNVFIGVDSARVKQGEFELL

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	98	319	1.1e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	765	1	765	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.34e-130	46	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	6.40e-118	45	464	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.71e-86	87	765	64	776	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.51e-71	395	648	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPO96569.1	0.0	1	765	1	765
QET58492.1	0.0	1	765	1	765
BBV40202.1	0.0	1	765	1	765
BBV50440.1	0.0	1	765	1	765
QGS15877.1	0.0	1	765	1	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R5I_A	0.0	34	765	3	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	0.0	34	765	3	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	0.0	25	765	28	765	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	0.0	34	765	4	734	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXL_A	9.78e-229	30	764	6	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	0.0	1	765	1	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	0.0	1	765	1	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.14e-130	74	754	34	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.43e-121	24	764	29	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.06e-104	13	751	7	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999094	0.000178	0.000155	0.000151	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001705_01727.