CAZyme Information: MGYG000001706_00417

Basic Information

• Species: Campylobacter_A curvus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A curvus
• CAZyme ID: MGYG000001706_00417
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	MGYG000001706_1|CGC2	80519.29	8.555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001706	1971264	Isolate	South Africa	Africa

• Gene Location: Start: 431020; End: 433146 Strand: +

Full Sequence      

MMDKEGFSSYFKNFHLSKQSVLLIAIAFVFSVVCRLYWVVWASEFSSFFWNGELMISTND
GYAFAEGARDMLAGFHQPNDLSYFGYPLSTLTYWIVKIFGVKLEAAMLYMSVFFSSLVVI
PILLISLEYKNPKAGLIAALLGSIADSYYNRTMTGYYDTDMLIIPLSVFMLWGLVRVLEK
RDTASIIIAPVSILIYMWWYASAFSLISVSAGIFLVYTLIFERRNRACYAQLVLLVLSIT
NIDIYVKILLVFGFYLGVLFKKELLNFKFILAALAASFALFVIGGGLNPIIFQLKFYVFR
AVPESAGVSFKYFNVNQTIQESGIVDLQLFCERISSSVLTFLVSLAGVIMLCVKHRSFLV
TLGMLFLGFLALKGGLRFTIYAVPVMAIGFGYFVVYFLEILKLKPASFNAAYCLIAVFAL
LPALSHIYNYKASPVFSRSEVEILNKLKGIAGREDYVLAWWDYGYPIRYYADVKTLIDGG
KHLGRDNYAVSYALGSDEMSSANMARIEVEYTERKFNERFASNMTQILEDRNISDVNVFL
SGLKDQNLSLPPKTREIYYYLPDRMLYIFPTILQFSRLDLKNGKSHAEGIFFIASAIAQD
ERGINLGNGFVLSSDVSTLSYNGMKMSLAAFIETSYDEKGRLNVKEYKNDENSKIYVIFM
RDYGRFLILDESMINSAYIQLFVLERYDERLFEPVILSGAAKVYRLKR

Enzyme Prediction     

EC	2.4.99.19

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	585	3.7e-101	0.8643578643578643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	2.50e-50	23	480	9	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	5.99e-45	1	486	2	529	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam18527	STT3_PglB_C	8.16e-29	590	668	1	79	STT3/PglB C-terminal beta-barrel domain. Asparagine-linked glycosylation is a post-translational modification of proteins containing the conserved sequence motif Asn-X-Ser/Thr. The attachment of oligosaccharides is implicated in diverse processes such as protein folding and quality control, organism development or host-pathogen interactions. The reaction is catalysed by oligosaccharyltransferase (OST), a membrane protein complex located in the endoplasmic reticulum. The central, catalytic enzyme of OST is the STT3 subunit, which has homologues in bacteria and archaea. Structural analysis of a bacterial OST, undecaprenyl-diphosphooligosaccharide protein glycotransferase EC:2.4.99.19 (PglB) protein, revealed two domains: a transmembrane domain and a periplasmic domain. This entry represents the C-terminal periplasmic beta-barrel domain.
COG1807	ArnT	2.01e-05	63	260	37	237	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAU00971.1	0.0	1	708	1	708
QKF60724.1	0.0	1	708	1	708
QPI03438.1	0.0	10	708	6	699
QPH86773.1	0.0	10	708	6	699
QPH88490.1	0.0	10	708	6	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	6.82e-210	18	708	14	712	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	5.11e-204	18	708	14	712	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	7.33e-204	18	708	14	712	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	5.48e-57	432	706	7	289	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C8	7.08e-212	23	707	17	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
Q5HTX9	7.08e-212	1	707	1	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
B9KDD4	8.11e-208	18	708	14	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
105	127
161	178
198	220
232	254
269	291
337	359
379	401
408	430