CAZyme Information: MGYG000001706_00475

Basic Information

• Species: Campylobacter_A curvus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A curvus
• CAZyme ID: MGYG000001706_00475
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		62157.25	9.4827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001706	1971264	Isolate	South Africa	Africa

• Gene Location: Start: 483257; End: 484864 Strand: +

Full Sequence      

MNKFAFLVPYYNHPQNIKELVAALKLHDIPIIIVDDGSDEPSKAVLRELEDVLLLTRPNN
DGKGAAMKDGFEFAFEKGFTHAFQIDADFQHDVGMIERFLQASRNFPQSIICSNPVYDEN
APRSRVYGRKITNFWVRVNALTTKMKDTMCGFRIYPLETIKEAVQKSKTNRMEFDMEILL
NASRQGVDMRWIDIKVRYEKDGVSHFKMLRDNALISLMHAKYFFSLPKFIFLKFFKDKDK
LWWQKGERANAFFLELTLFLVRYTPTFILNFIIKIVVLFYYIFSKNERENIKNFRRNLKR
FSGREFSTQAFENFYEFGVAICDKFRVWQDKISKDELDKVNAKLIDDELVGAKKGQVIIT
SHLGNAEICKAISTNVDGFEMVVLVYTKGSENFYEIMNKISLGKIRLLNVNELDVSAMLE
LKNIVDSGVHIGVMGDRVPINGDKFMSVRFLGKEAKFNYGPYLLAAILGVKVSSLWCEKI
DGKFRIELMPIAQSIALSRDKAASVRPYVQKYVKQLEEHCLKAPSQWFNFFDFWR

Enzyme Prediction     

No EC number prediction in MGYG000001706_00475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	126	4.9e-19	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4261	COG4261	1.59e-44	242	534	4	299	Predicted acyltransferase, LPLAT superfamily [General function prediction only].
cd04179	DPM_DPG-synthase_like	5.90e-34	7	180	2	183	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd07984	LPLAT_LABLAT-like	3.50e-20	347	535	13	192	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lipid A biosynthesis lauroyl/myristoyl (LABLAT, HtrB) acyltransferases and similar proteins.
cd06442	DPM1_like	5.69e-20	7	187	2	190	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04188	DPG_synthase	2.88e-15	8	194	3	207	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAT99841.1	0.0	1	535	1	535
QKF60778.1	0.0	1	535	1	535
QCD52721.1	1.43e-261	1	535	1	538
QCD49273.1	3.92e-253	1	535	9	573
QKF92319.1	6.48e-251	3	534	4	538

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA58	5.42e-10	7	198	9	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
Q9LM93	1.67e-09	3	194	14	215	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
Q57964	1.47e-08	7	233	4	229	Uncharacterized protein MJ0544 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0544 PE=4 SV=1
A0QZ12	4.16e-07	7	212	27	240	Polyprenol monophosphomannose synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ppm1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
261	283