CAZyme Information: MGYG000001706_01083

Basic Information

• Species: Campylobacter_A curvus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A curvus
• CAZyme ID: MGYG000001706_01083
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000001706_1|CGC7	38340.36	7.3802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001706	1971264	Isolate	South Africa	Africa

• Gene Location: Start: 1105155; End: 1106207 Strand: -

Full Sequence      

MKFKILAALCFLALNLCAADVSLRAKASQMVMVGFNGTSTKDASVRAMLSDVGYERFGGV
VLLGRNVKNKAQLQALTKAIKDKNPKIFIAIDEEGGNVTRMKDASFGGPYPSAKEVAATL
DIKQAAEIYEQMADELKQSGINVDLAPVVDLHDEASPIIGAKERAFSENASKVIFYANAF
MDAFKRDGIITTLKHFPGHGDSKEDSHKSKSEVVLTKEALLPYRDAISTNRAELIMVGHL
YVKELDEANPATLSKKIIGDLLRGEFKYDGVVISDDMLMKGAGDGPLKEKIIKFINAGGD
ILLFSEFKIGERRTAELVVQYILDAINENKISKERIDESYKRIMALKAAL

Enzyme Prediction     

No EC number prediction in MGYG000001706_01083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	303	5.8e-48	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.44e-71	21	350	1	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.38e-61	22	346	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	7.41e-49	30	303	3	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	8.63e-07	110	347	120	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAT99946.1	1.08e-245	1	350	1	350
QKF61351.1	6.98e-242	1	350	1	350
QPH91748.1	1.22e-180	3	350	4	351
AVX43932.1	7.02e-180	3	350	4	351
QPI03065.1	7.02e-180	3	350	4	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	8.71e-46	21	347	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.65e-40	21	347	42	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.44e-39	21	347	16	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.40e-39	21	347	46	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3TEV_A	2.81e-36	58	345	45	333	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	1.82e-40	58	350	65	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
C4LEY6	2.57e-39	42	310	14	282	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
P40406	4.74e-39	21	347	42	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P44955	1.51e-36	59	310	28	284	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
Q0A911	2.02e-35	31	303	6	281	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000411	0.998841	0.000239	0.000156	0.000157	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001706_01083.