CAZyme Information: MGYG000001707_01754

Basic Information

• Species: Coprococcus sp000154245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp000154245
• CAZyme ID: MGYG000001707_01754
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39187.34	10.3809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001707	2954116	Isolate	not provided	not provided

• Gene Location: Start: 770; End: 1831 Strand: +

Full Sequence      

MRKGKRLIAWIMAVVMLFTICVFGGNGTAEAAATTPVAKHGRLSVKGADLVDSKGNKFQL
RGISTHGINWDVGSPYVNKKAFKTLRDDWGVNAIRLAMYTEEYNGYCSGGSQAKLRKLVD
KGVGYATDLGMYAIIDWHILSDGNPNKNKSQAKKFFTTMAKKYKNNKNVIYEICNEPNGC
SWKEIKSYATDIIKTIRKYDKKAVIIVGTPTWSQLGTDGTSNEVADSPIKGYKNIMYSLH
FYASEWAHNEYLPAKVAYARKKKLPIIVSEFGLSPASGDGAINKASADKWMKLLNKYNIS
YFCWSLSNKNESASLLKPSTKKTSGWKSGDLSTAGKYIKKKYLARKKALGKKA

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	302	1.3e-89	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.68e-71	51	310	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.89e-15	27	245	31	278	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83458.1	9.67e-185	3	353	2	358
QNL99979.1	6.85e-122	5	345	6	341
AFA47670.1	3.37e-107	35	350	197	505
CBK83877.1	1.40e-104	24	345	204	530
QNM00780.1	2.10e-103	35	340	213	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZT_A	2.59e-90	25	343	18	325	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
6GJF_A	6.82e-90	34	339	4	297	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	9.40e-90	35	343	4	303	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	4.04e-86	35	343	4	304	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	8.07e-74	37	341	3	296	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	1.43e-88	5	346	2	333	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	7.00e-86	5	346	2	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P07983	7.77e-85	5	339	2	326	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	5.92e-81	5	340	12	333	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P22541	4.34e-79	40	338	113	403	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000322	0.998784	0.000379	0.000173	0.000155	0.000142

TMHMM  Annotations     

start	end
7	29