CAZyme Information: MGYG000001708_00735

Basic Information

• Species: Providencia rustigianii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rustigianii
• CAZyme ID: MGYG000001708_00735
• CAZy Family: GT35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217	MGYG000001708_25|CGC3	24795.14	4.7962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001708	3896203	Isolate	not provided	not provided

• Gene Location: Start: 228357; End: 229010 Strand: -

Full Sequence      

MNPPFHIQSQEQRIDNLVDAIQTKLKFMVGKDPIIATSHDWLNAISYAIRDLTVDRWLRG
IRRSLSQSDRAIAYLSMEYLIGRTLSNTLLNLGMYEDVSAALEKMGFSLDDVVQEEDDPG
LGNGGLGRLAACFLDSLATLKIPSVGFGIRYEYGMFQQNIIDGQQVESTDRWLQYGNAWE
FPRYNLSYKVRFAGRIQQEGKIVRWIETEEVLARAYD

Enzyme Prediction     

EC	2.4.1.1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	4.53e-101	1	217	1	217	glycogen phosphorylase; Provisional
cd04300	GT35_Glycogen_Phosphorylase	2.63e-75	19	217	2	204	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0058	GlgP	7.11e-49	13	183	5	174	Glucan phosphorylase [Carbohydrate transport and metabolism].
pfam00343	Phosphorylase	9.91e-45	102	217	1	120	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	8.78e-39	37	217	30	206	maltodextrin phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEB75546.1	8.44e-155	1	217	1	217
VEH56813.1	3.56e-150	1	217	1	217
QLR04476.1	1.36e-135	1	217	1	217
ATG15988.1	1.08e-134	1	217	1	217
QLQ97174.1	1.08e-134	1	217	1	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FC0_A	2.22e-55	12	217	22	227	HUMANLIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1FA9_A	2.22e-55	12	217	22	227	HUMANLIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1XOI_A	2.22e-55	12	217	22	227	HumanLiver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]
1EM6_A	2.24e-55	12	217	23	228	HumanLiver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EM6_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EXV_A Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1EXV_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1L5Q_A Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5Q_B Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5R_A Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5R_B Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5S_A Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L5S_B Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_A Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_B Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens]
2QLL_A	2.24e-55	12	217	23	228	Humanliver glycogen phosphorylase- GL complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC87	1.72e-93	1	217	1	217	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1
P0AC86	1.72e-93	1	217	1	217	Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
Q9CN90	4.84e-69	4	217	9	222	Glycogen phosphorylase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=glgP PE=3 SV=1
P45180	1.36e-65	4	217	9	222	Glycogen phosphorylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgP PE=3 SV=1
P73511	5.76e-59	7	217	15	234	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001708_00735.