CAZyme Information: MGYG000001709_00005

Basic Information

• Species: Collinsella stercoris
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella stercoris
• CAZyme ID: MGYG000001709_00005
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1463	MGYG000001709_1|CGC1	156442.73	4.4082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001709	2399821	Isolate	Japan	Asia

• Gene Location: Start: 5094; End: 9485 Strand: -

Full Sequence      

MNAQRMRGGALRRLVLAACASLALVAAPATALAAQTYQVYPTPHAIEYGEGEVTLPETVN
VVLDPGVDAETEKRLNDILALKQIKANKVDALGKDANAVEVLVGINGSKGPVDQLVQSGA
VTPQADLFKKTDANFVTVLPKGKDAPARIVVVGRDTDAAFYGLSTLYQVFQQIEGRALAA
FTVNDWADVETRGFIEGYYGNPWSTEDRAELMRWGGLFKQNAYIYAPKDDPKHNAQWRDL
YSDEEITKLSQLAQAGNESKCRFVYALHPFMNNPISFGSSYESDLATLKAKYLQVIDAGC
RQIMLSADDADNPGSSNYIKLLNDLTSWLHDLQKMKNEDGSLKYPGLKDTIPFVAANYAQ
AGESWYKNLPSNVKPIMTGTRVWGKADKSTISTFTSRSGVAPFMWINWPCTDNTRDHLSM
GGYENALGADVVPGSLVGCVINPMQQSEPSKVGIFLNADFSWNNWTSYDHADKVWNDAFS
FVDHDSPADTDASNALRTLSEHMKWYQGGGVTFESRESEAVKPMLDAFRAKVEDGSVKVS
DIDQVEALFKELLAAAGTYAQNAGNASLRTQIDPWLGFWSDGMNAGLRYLGALRGHLNGD
KNALVSEYTQGKELFDNALLHSYPYVNDTQYARAGTRAVWPVVEALGECLRPVVGDATGT
VDVVAEVTLKGLGTSGNPANIIDGDTSTYAHFSGSNATTNVNVGDSFTITYEPYQRADAV
TFVQSVPSNRPQDVLKDALVEYTTDGTTWVELGHVNGDSEQTLKLPKTTDLKGLRFTNKQ
YYSGYWQVNEVATSVATSKPYEPFASEKPAQGELSAIVDGDVKTGASFDAPAKGMNAGLS
YVKTTEIGMVEIAQGEDARSGKVEALIGGAWTKIGTFDAKASQTVELEKNTAVNGVRLVV
EGEGAWNLNEVAAKRLPSKVTPVMNETMGEYESFTIDKIADGNEGSYAHLKNLKDNNIRA
NDWVGLTFEPSARIGKIAFVQAPDGGDVIVKGKVEYQAEDGSWHKVGDVTSAQKQTFEFA
NVNAKAIRVTNLENTAKWWKVYELSAEEGYESPAGAILTDIEGTALAGTADSTSAAISAG
KVAIPAGSYVAIDLASVQANIAIDEASAAAVAKAGLTVVSSVNVLSWDAVENNAVASARY
VGVRNLSDHEITFDFSADPFRVTYPGVPGDFTCDSDPVDEAHGTSAMLDGRVTTYWCPAN
ASGTLTYHVSEPLSGDLPRNGVHIVSWGDPSGAKVTATVYDKPDYSSTTEVELGTLDASV
NDFSFAEAANGRFWGVKEVKVSWSDGAVPSIAEVSMLDTTFEPQPLPETHKVTFMVDDTV
FSEVEVEDGSAVAAPENAPAKDGFTFDGWYLDDAAYDFAAPVTGDLTLVAHFTPKDDQGG
DQGGDQGGDQGGDQGGNQGGDQGGDQTPDPDDKPGTNPGNKPSGKPGAGLPSTGDSAMLA
VVGVAGVAVAAFAAGAVMKKHRA

Enzyme Prediction     

EC	3.2.1.35	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	192	500	1.6e-86	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.66e-98	192	499	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	3.46e-15	36	185	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam09479	Flg_new	5.85e-10	1310	1371	1	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
TIGR02543	List_Bact_rpt	1.48e-04	1339	1375	1	42	Listeria/Bacterioides repeat. This model describes a conserved core region, about 43 residues in length, of at least two families of tandem repeats. These include 78-residue repeats from 2 to 15 in number, in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few bacteria. [Unknown function, General]
NF033188	internalin_H	0.003	1230	1373	284	411	InlH/InlC2 family class 1 internalin. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin H (InlH), or internalin C2, two class 1 (LPXTG-type) internalins that are closely related, one apparently derived from the other through a recombination event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT17802.1	1.48e-228	23	1297	27	1503
QQV04685.1	2.95e-191	37	1261	53	1279
QMW73896.1	7.88e-191	37	1261	53	1279
QPS12837.1	7.88e-191	37	1261	53	1279
QQY28346.1	1.09e-190	37	1261	53	1279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV4_A	1.02e-153	37	655	32	649	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PWI_A	4.20e-96	37	650	34	624	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV5_A	2.82e-48	39	617	42	599	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2CBI_A	8.50e-42	41	552	18	495	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	1.08e-41	41	552	20	497	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	6.03e-164	37	1302	39	1356	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	5.41e-40	93	576	51	520	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	8.92e-40	41	552	48	525	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.18e-39	41	552	48	525	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	9.61e-24	193	464	63	335	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000484	0.998498	0.000264	0.000331	0.000220	0.000175

TMHMM  Annotations     

start	end
13	35
1436	1458