CAZyme Information: MGYG000001709_01540

Basic Information

• Species: Collinsella stercoris
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella stercoris
• CAZyme ID: MGYG000001709_01540
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000001709_110|CGC1	55562.31	4.7168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001709	2399821	Isolate	Japan	Asia

• Gene Location: Start: 635; End: 2077 Strand: -

Full Sequence      

MGFKEGFLWGGATSASQCEGSFDLDGKGLSVSDVVSSGSHHSPRRICLDRDPAYAFPSEW
GSDCYRRFEEDIELFTEMGFKAYRFSIDWSRIFPHGDDAEPNEAGLDHYERLLSALREHD
IEPVVTLSHSEMPLNLVKKYGGWRNKRVIEFYVRYCSAVFFRYRGLVKYWLPFNEVNDML
LPMSAFGQGGIYHDGTESFTEQPDYPNERMNALNNILIASARAVKIGRDINRDFSFGTMI
CHITQYPRTCCPEDQLLVQMDDLYRNCMCSDVMLRGEYPYYAWTYFRRHGIELELTDKER
ADLKAGTCDFYTFSYYQSICQTTRAEEFGDQTGGNIMGGVRNPYLELTDWDWPIDPVGLR
YTLNKVYDRYRVPVMITENGLGAVDVFEADGSIHDQYRIDYLRRHIEEMRKAVDDGVDLI
GYTPWGCIDLVSMSTGEMKKRYGFIYVDADDEGNGTFDRFRKDSFYWYKRVIATNGEDLS

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	476	1.4e-135	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	479	2	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	480	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	2.30e-178	1	480	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	6.36e-174	3	480	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	6.47e-161	7	479	10	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ61437.1	3.59e-203	1	480	1	472
QZO10741.1	8.34e-202	1	480	1	472
QLD12798.1	1.63e-201	3	479	7	480
BCZ48952.1	5.17e-201	2	479	8	486
AIY84570.1	7.56e-201	1	479	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.95e-173	3	479	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.54e-157	7	479	12	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.04e-155	5	479	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.97e-155	5	479	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.44e-150	5	479	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	5.35e-168	3	479	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	2.29e-164	7	479	8	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	8.46e-157	7	479	12	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	1.47e-153	1	479	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	4.05e-151	3	479	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001709_01540.