CAZyme Information: MGYG000001710_01842

Basic Information

• Species: Extibacter hylemonae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Extibacter; Extibacter hylemonae
• CAZyme ID: MGYG000001710_01842
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000001710_72|CGC1	40998.56	6.2846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001710	3802096	Isolate	Japan	Asia

• Gene Location: Start: 76045; End: 77127 Strand: -

Full Sequence      

MNVLILSSQFGMGHQMAAKAIGEEIKKQNEDARVTELDLLTYCYPRVSRYIFKLFHMLVE
HCYGIYNMVYKLSGKMKVDIKPSGITVYKKLQKLMDEYEPDMIVCTLPLCAKSIASYIEK
TGCRIPLVTCITDISIHPEWITPQTDAYLAPTNEVKESLVERGTAPENVFVTGIPVRQQF
LENTGKQRDKVTKVLIMGGGLGIIPNLDELIDMLHHTPGVSATIITGKNQKAYDTWHGKY
DDIEVLGYTENMSDHVKEADLVITKAGGITLFELIHCEVPLFVIHPFLEQEVNNARYAQE
HGIARVIWDKTTDFTGILKEFLSDDRQWQEMKKNMRRVKREIMECSVEDAMRTVAERMAA

Enzyme Prediction     

No EC number prediction in MGYG000001710_01842.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	194	340	6.1e-28	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	3.64e-85	3	352	1	360	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	9.30e-62	2	341	6	355	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	3.31e-40	4	341	3	341	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	6.53e-39	3	339	8	353	diacylglycerol glucosyltransferase; Provisional
cd03785	GT28_MurG	4.38e-26	12	356	10	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK18734.1	5.32e-267	1	360	1	360
QYX28289.1	3.19e-197	1	360	1	360
QRO38199.1	2.34e-194	1	360	9	368
QBF75013.1	2.34e-194	1	360	9	368
QAS59468.1	2.22e-108	1	344	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	8.82e-08	165	311	158	320	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	3.65e-06	108	312	93	309	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FED1	8.11e-43	3	336	7	350	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	3.09e-42	2	336	6	350	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
P54166	6.11e-41	3	336	7	350	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
B9DQ98	5.73e-36	3	339	8	353	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
Q6GAR0	7.96e-35	3	306	8	321	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001710_01842.