CAZyme Information: MGYG000001711_00099

Basic Information

• Species: Holdemanella biformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemanella; Holdemanella biformis
• CAZyme ID: MGYG000001711_00099
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840		95386.87	4.7401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001711	2415920	Isolate	not provided	not provided

• Gene Location: Start: 29; End: 2551 Strand: -

Full Sequence      

MKRLITCLFTFVVVLGFCTQSIYATSAGTDETNNNSFVGFDENGNLIQYDPEELEEELAS
SMVSTVMLAEETKDVTYGVVNFRTKASANEITTYTNCTNGEQGYINGYTMSDGAYLGMVN
GKVKFKAAGVTGLVDASEVQIVDYANANTISCYKTNGGSLYHYVANLISQYSNYYSKTYV
GNKPASLSDNATYYSYDGHYFYADFKTMIQDYKNGVYTNAVNSNAPYYNYFQYLPARTKT
SITAAQFDQYTSSQVSSGKLLNAGASLVSNQNKYGVNALMMYSNAVLESGWGQSQIAMDK
NNLFGHGAADNNPYYGANGYSSVDDCIQYHAKVFISESYCDPKDYIGRYYGSHLGDKESG
INVKYASDPYWGEKIASLCWEVQNGLGINEVNAYSIGMANGSVSYYTNPGSNLLFSSKNV
GAYPIVLLAKQDGYYKVQSDATLNSNRTSVTQDNGAYDFDLYYAYISESAVTPLNSVKKE
SKWVQDENGNWYWYENNSYVTGWKQIQSKYYYFDSNGVMQSNKWIGNYYVGSDGAMLKNQ
WIDDRYVDSNGLYTPAQWIYNGKWWYRHSDGSYTKNDFEDIDGQTYYFDGNGYMVTGWRQ
IKSDWYLFNGSGVMVKNSWSGNYYLEKDGKMAKSKWVGAYYVDSNGVWQQDRWIYNGRWW
YRYGDGSYPRNKFDVINNNVYYFDNGGYMLTGWQVINGNWYYFDGSGIMAKSRWIGNYYV
GNDGIMAKNQWVGDYYVDGNGLWTPSKWMYNGNWWYRYTDGSYPTSKFDIINGATYYFND
AGYMLTGWQVINNNSYYFNGSGAMVKNAWVGNYYLQSDGTMATNTWIGNYYVGSDGCWRG

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	266	381	5.2e-23	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	3.23e-32	483	743	445	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	7.16e-31	561	838	449	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	3.68e-30	483	743	488	682	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	6.87e-28	648	838	488	682	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	4.59e-25	648	836	445	619	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM11023.1	1.04e-102	77	474	137	548
QUN13370.1	5.43e-100	64	481	122	547
QEK17141.1	1.72e-94	39	475	55	492
BCL58959.1	1.08e-92	12	521	52	553
AWY97555.1	5.49e-89	17	476	22	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	1.92e-27	128	387	65	287	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
4IWT_A	3.72e-07	564	596	13	45	Crystalstructure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080],4IWT_B Crystal structure of the C-teminal choline-binding domain of the Streptococcus pneumoniae prophage LytA [Streptococcus pneumoniae GA60080]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	2.17e-25	128	387	433	655	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	2.54e-25	128	387	477	699	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000844	0.914447	0.083963	0.000250	0.000251	0.000224

TMHMM  Annotations     

start	end
5	27