CAZyme Information: MGYG000001712_02360

Basic Information

• Species: Bacillus_A thuringiensis_S
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A thuringiensis_S
• CAZyme ID: MGYG000001712_02360
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215		24500.14	9.4115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001712	5736823	Isolate	United States	North America

• Gene Location: Start: 2344878; End: 2345525 Strand: +

Full Sequence      

MKDTSKKQIIKVFLISILGLGIILGMLYFNHKTNIQQNKALATEKRVLQYESTLKKELEK
YNLGEKTAVLLGIMYQESRGEGNDPMQSSESLGLKPNEIQETSLSIKQGVKHFAKMYKYG
TDKDVSMDTIIQSYNMGPGYIDFIASQEVKQHSEDSAKTFSKMKVDQNPAMYTCGGNKNN
FRYPYCYGDFTYATKVNEKTKLIEELLRNVHISSK

Enzyme Prediction     

No EC number prediction in MGYG000001712_02360.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	9.02e-63	50	198	1	148	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	8.55e-56	45	200	2	165	Lysozyme-like.
cd00254	LT-like	0.007	68	142	2	86	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	0.007	70	141	15	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC62133.1	4.02e-153	1	215	1	215
AXR22810.1	4.02e-153	1	215	1	215
QGV08621.1	4.02e-153	1	215	1	215
QFP88942.1	4.02e-153	1	215	1	215
AZV66358.1	4.02e-153	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.13e-18	30	198	9	176	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	3.89e-18	47	198	24	175	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34636	2.47e-66	23	208	26	212	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
Q8DPY9	6.33e-15	45	187	29	164	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q9AHT6	6.33e-15	45	187	29	164	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
P0DC90	5.78e-13	46	204	29	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	5.78e-13	46	204	29	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.947574	0.015402	0.005238	0.000191	0.000094	0.031515

TMHMM  Annotations     

start	end
12	29