CAZyme Information: MGYG000001712_03204

Basic Information

• Species: Bacillus_A thuringiensis_S
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A thuringiensis_S
• CAZyme ID: MGYG000001712_03204
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40964.57	9.1547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001712	5736823	Isolate	United States	North America

• Gene Location: Start: 3167194; End: 3168261 Strand: -

Full Sequence      

MKKNKSLISFLGVFIMLFSFCFQGNVQADVNTVQSGKIKSGNVTVWEVGNVAKVLADVER
LNLNTVNVPIQVDIPNVTSTNMVINQAQKQQAIILIQELLKRNIQVIVEPFPYIQQGNVG
ETEWNPSNINDFFWNWKTVILQDIFNSITSKYNVYGLKIASNFVNMEYAEGYWSDTIDFV
RNQYKGNILYQMNWWLTASWDPSYEAKFKEKINRPYLKKVDIVSIDSWFEVSGKRNPTYE
EVKKSLFATTVYNRGQNVVQQLEQLHNATGKPVYFGGFNVPARELGLQNPWNPDVSNVFS
KDVQLNGWRAYRDVLEPKPYFKGFSIWFIGSNDSTHAYQIHSKEAEAVINGWYRK

Enzyme Prediction     

No EC number prediction in MGYG000001712_03204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	45	349	4.2e-39	0.9509803921568627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	9.77e-50	36	353	1	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	9.52e-10	92	353	64	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACK93720.1	7.26e-267	1	355	1	355
AZV67092.1	1.03e-266	1	355	1	355
QGV07990.1	1.03e-266	1	355	1	355
AMR85685.1	1.03e-266	1	355	1	355
AXR23745.1	1.03e-266	1	355	1	355

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000477	0.674058	0.324685	0.000292	0.000261	0.000206

TMHMM  Annotations     

start	end
7	26