CAZyme Information: MGYG000001712_03731

Basic Information

• Species: Bacillus_A thuringiensis_S
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A thuringiensis_S
• CAZyme ID: MGYG000001712_03731
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265		28907.09	10.2132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001712	5736823	Isolate	United States	North America

• Gene Location: Start: 3695253; End: 3696050 Strand: +

Full Sequence      

MKLLKIKHIIPLSAAAITFVCSQSTAEASTIHTVKKNDTLWGISKQYGVSIQSIKQANNK
GNDKTFIGEQLHIPGSVKSNEITVPQNAKPASISGQIIYQVQPGDSLETIAKRYNVTVQS
IKQINNTVGNKLYTGQHLKINSSISQKEKDLMARLVTAEAGGESYKGKVAVAKVILNRVN
AKGFPNTITGVIYEPIKYGYAFTPVTDGRINQPASAEAKMAVEEAISTNGVHSDWIYFYN
PKTSTDKWITTRQTVAVIGNHVFAK

Enzyme Prediction     

No EC number prediction in MGYG000001712_03731.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3773	CwlJ	5.07e-41	141	265	111	242	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
pfam07486	Hydrolase_2	3.39e-40	162	264	1	101	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
PRK06347	PRK06347	3.40e-16	22	140	472	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.61e-14	22	145	398	528	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	6.23e-14	24	145	325	454	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC58130.1	3.42e-188	1	265	1	265
AND09098.1	3.42e-188	1	265	1	265
QFP90233.1	3.42e-188	1	265	1	265
AND25605.1	3.42e-188	1	265	1	265
AFQ27545.1	3.42e-188	1	265	1	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	2.74e-29	135	265	2	128	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	2.63e-26	130	265	91	222	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31685	1.70e-36	145	264	92	207	Uncharacterized protein YkvT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvT PE=2 SV=1
P0A3V0	1.14e-26	140	265	138	259	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	1.14e-26	140	265	138	259	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
P59105	6.27e-25	138	265	153	276	Spore cortex-lytic enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=sleB PE=3 SV=1
P50739	1.05e-22	145	265	189	305	Spore cortex-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000403	0.588352	0.410597	0.000228	0.000205	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001712_03731.