CAZyme Information: MGYG000001712_04483

Basic Information

• Species: Bacillus_A thuringiensis_S
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A thuringiensis_S
• CAZyme ID: MGYG000001712_04483
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		38193.85	3.9743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001712	5736823	Isolate	United States	North America

• Gene Location: Start: 4405862; End: 4406833 Strand: -

Full Sequence      

MAADHSLRFSLKESVWFQKGQEVDELLSISLDPDVEIEELDHEVIVRGQLDLTGEYVARQ
DDSAYSLRELSPAKSIDYVETREDGVNELVHSFPLEISIPRNRVKVIEELYVSIEEFDYE
LKENGCLQLLADISITGLCDEERSEDEEETVYADLEEDSAQEDENRPAPHVEEPTYKESD
EWEDYAFEPFQLEERKEQELEEEKIEEHEFVEREEEQETTPQFELFGRKDFKKEKAKKQE
EQEEEYSQRDENALYLTKLFTKEPEEEFTKLRMYFVQEGDTIESIADRYETSVQNLYRVN
QTEDIFLNMGQIIYIPVSRVKAK

Enzyme Prediction     

No EC number prediction in MGYG000001712_04483.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02907	spore_VI_D	2.43e-113	7	316	1	338	stage VI sporulation protein D. SpoVID, the stage VI sporulation protein D, is restricted to endospore-forming members of the bacteria, all of which are found among the Firmicutes. It is widely distributed but not quite universal in this group. Between well-conserved N-terminal and C-terminal domains is a poorly conserved, low-complexity region of variable length, rich enough in glutamic acid to cause spurious BLAST search results unless a filter is used. The seed alignment for this model was trimmed, in effect, by choosing member sequences in which these regions are relatively short. SpoVID is involved in spore coat assembly by the mother cell compartment late in the process of sporulation. [Cellular processes, Sporulation and germination]
pfam01476	LysM	1.24e-08	274	316	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.33e-08	274	315	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.16e-05	274	315	2	44	Lysin motif.
COG1388	LysM	0.005	274	318	69	113	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH07756.1	4.02e-200	1	323	1	323
AQY40956.1	4.02e-200	1	323	1	323
AND26384.1	4.02e-200	1	323	1	323
AZV68290.1	2.36e-199	1	323	11	333
QBC64054.1	2.36e-199	1	323	11	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37963	2.53e-31	1	152	1	150	Stage VI sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoVID PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001712_04483.