CAZyme Information: MGYG000001713_00854

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_00854
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		26705.85	10.3773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 43728; End: 44444 Strand: -

Full Sequence      

MKLRSLLCHQSHSKLYRLTGSFLLLLLSAHTTARSLDDAIASQRALLSPYQRQIESRLET
YQPLLAHIFNQLDHKKLPQQLALLPMLESSFDPNAISHAGARGLWQLMPATAQRYGLQTA
PNDQRLDVFASTDAALNYLAFLHRKFGGDLALTLAAYNAGEGRVARAIQRAGSREFHRLS
LPQETRQYVQRFYALTQLIDVTALNHAAFQPLMLFSSQPAITRQALINLQPLPPLVKL

Enzyme Prediction     

No EC number prediction in MGYG000001713_00854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	70	199	7.8e-28	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.08e-55	76	197	5	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	3.51e-44	62	199	102	244	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	5.61e-33	78	176	12	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.70e-31	88	191	31	141	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.32e-30	88	191	11	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC93568.1	1.75e-146	25	238	1	214
ADT86533.1	1.01e-145	25	238	1	214
QSA19838.1	1.38e-143	25	238	1	214
QKE35764.1	7.95e-143	25	238	1	214
QTG97289.1	1.60e-142	25	238	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.88e-09	88	190	474	583	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.91e-09	88	190	503	612	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.59e-09	88	190	474	583	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.60e-09	88	190	475	584	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	4.93e-08	75	164	464	559	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.47e-33	50	199	90	241	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.47e-33	50	199	90	241	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	5.55e-25	62	168	23	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31976	8.74e-10	78	194	1437	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	8.74e-10	78	194	1437	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.142822	0.810948	0.045000	0.000454	0.000330	0.000408

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_00854.