CAZyme Information: MGYG000001713_01103

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_01103
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		55120.01	5.5307

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 319143; End: 320609 Strand: +

Full Sequence      

MDSNIEHLNVWFVVSEAEGLVKSGGLADVAKALPKALVELGHQVALVLPGYRSIADKDAA
PVILETELTHWPHIRYQVRQRDLDGVPVYLIDCDPYFDRPELYAESNQAYPDNGERFGFF
SAACLDVLPKLNIKPDIIHANDWHTGLVPFLLKTRYREDPYFDGVKSVITIHNAMFKGIF
SYHQLDVIPELNLSGMEFLQYGHDHISMLRAGIAFADKINAVSPNYASELLTPLGSHGLV
DDFVRRARDLHGIINGCDYTEWNPKTDRYLPATYSDDAASLKQGKMASKTALQDELQLPK
RDVPLFGMVCRLTHQKGFHYILPILEHFLRNDVQLVIVGTGEPEVAAKLHKIAAAHADKF
AFVEAYSNRFAHLVEAGSDFFLMPSEFEACGLNQIYSMAYGTLPIVREVGGLKDTVLDYD
KYPNEATGFGFQEPSPEALLITMQRALLFYLQHPDEMVKVQQRAMQKDFSWKESALDYIK
MYRLAIFD

Enzyme Prediction     

No EC number prediction in MGYG000001713_01103.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	9	483	2.2e-168	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	8	485	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	0.0	9	486	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	9	483	1	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	8	483	1	461	glycogen synthase GlgA.
PRK14099	PRK14099	3.02e-103	8	483	4	477	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADT86785.1	0.0	1	488	1	488
QTG90078.1	0.0	5	488	1	484
QTG97431.1	0.0	5	488	1	484
QDC94168.1	0.0	5	488	1	484
AVH33209.1	0.0	5	488	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QZS_A	2.04e-82	8	482	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3D1J_A	2.31e-82	8	482	1	473	ChainA, Glycogen synthase [Escherichia coli]
3COP_A	1.58e-81	8	482	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	6.18e-79	1	488	113	628	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
1RZU_A	1.81e-75	8	486	1	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C3LN49	1.04e-299	5	487	1	483	Glycogen synthase OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=glgA PE=3 SV=1
A5F7G0	1.04e-299	5	487	1	483	Glycogen synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=glgA PE=3 SV=1
Q9KRB6	1.04e-299	5	487	1	483	Glycogen synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=glgA PE=3 SV=1
Q5DZC1	1.74e-219	8	486	6	485	Glycogen synthase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=glgA PE=3 SV=2
Q87QX5	4.62e-219	7	486	5	484	Glycogen synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_01103.