CAZyme Information: MGYG000001713_02140

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_02140
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
138		15655.23	10.2524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 86612; End: 87028 Strand: +

Full Sequence      

MKALATQLIKKHEGLRLKPYRCSNQKLTIGYGRNLQDNGISQQEAETLLQHDLDAAVKEA
ETLPYFASLNEARQAVIVDMIFNLGLPRFGMFKKMIAAIEQQLWHVAANEMLNSRWARQV
GKRAKTLSEMMRTGAPLQ

Enzyme Prediction     

No EC number prediction in MGYG000001713_02140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	5	127	8.8e-26	0.9124087591240876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	7.72e-30	6	134	3	142	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
cd00737	lyz_endolysin_autolysin	9.22e-23	7	123	3	120	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
PHA02596	5	4.96e-18	6	134	176	331	baseplate hub subunit and tail lysozyme; Provisional
COG3772	RrrD	2.12e-11	5	125	11	135	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	2.51e-08	3	123	4	124	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC94443.1	1.15e-94	1	138	1	138
QTG97684.1	4.70e-94	1	138	1	138
QTG90322.1	4.70e-94	1	138	1	138
AVH34039.1	1.92e-93	1	138	1	138
AVH33438.1	1.92e-93	1	138	1	138

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QTZ_A	9.11e-18	7	134	5	156	ChainA, PROTEIN (T4 LYSOZYME) [Tequatrovirus T4]
176L_A	3.58e-17	7	134	5	156	ChainA, T4 LYSOZYME [Tequatrovirus T4],176L_B Chain B, T4 LYSOZYME [Tequatrovirus T4]
1L55_A	9.97e-17	7	134	5	156	ChainA, LYSOZYME [Tequatrovirus T4]
1L88_A	9.97e-17	7	134	5	156	ChainA, T4 LYSOZYME [Tequatrovirus T4]
156L_A	9.97e-17	7	134	5	156	ChainA, T4 LYSOZYME [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q556F2	2.24e-11	40	134	66	164	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
Q86AA1	2.34e-10	8	134	8	164	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1
Q9T1T5	8.99e-08	8	89	10	93	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
P16009	5.88e-06	7	134	178	334	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_02140.