CAZyme Information: MGYG000001713_02283

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_02283
• CAZy Family: GH5
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000001713_14|CGC3	44222.53	4.1011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 240701; End: 241906 Strand: -

Full Sequence      

MKYFNFCIVTLLFLFSNTVFAGLYVSGSVLYEYNGIPFKIRGINHAHAWYADKLETALQG
ISSTGANTVRIVLSNGHRWNKTSAEEVGNIIQLAKSYNLIAVLEVHDTTGYGEESSAADL
NSAADYWIEIKEKLIGEENYVIINLGNEPFGNGIISSDWVKAHKDAINRLRSEGMNHVIM
VDAPNWGQDWQNIMLDNATSILDSDPLHNIIFSVHMYEVYGDYSTVNNYISSFINKGLSL
VVGEFAATHKGSNVDESAIMERTETLSLGYIGWSWSGNDDSTADLDIVNNWNNDSYTKWG
NTLINGENGIKSTSQIATVFTCKDDCSGESTQYPICSSSSLDPDGDGWGWENEQSCIVQD
SNETAPNGYAYCSSESSDPDGDGWGWENNESCVVKGSNADY

Enzyme Prediction     

EC	3.2.1.78	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	282	2.7e-100	0.9881422924901185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.55e-37	34	279	4	272	Cellulase (glycosyl hydrolase family 5).
pfam02013	CBM_10	1.49e-05	325	358	1	36	Cellulose or protein binding domain. This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria.
pfam02013	CBM_10	3.30e-05	364	394	4	36	Cellulose or protein binding domain. This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria.
smart01064	CBM_10	1.52e-04	364	394	4	29	Cellulose or protein binding domain. This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria.
smart01064	CBM_10	1.82e-04	326	358	2	29	Cellulose or protein binding domain. This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC94577.1	8.37e-278	1	369	1	369
AMF93023.1	1.97e-276	1	369	1	369
ADT88758.1	5.64e-276	1	369	1	369
BAA25188.1	3.68e-187	11	362	11	363
AWB65998.1	4.06e-167	16	368	17	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BQC_A	2.51e-107	22	320	3	301	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]
4FK9_A	2.82e-99	21	320	22	318	HighResolution Structure of the Catalytic Domain of Mannanase SActE_2347 from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
1WKY_A	5.65e-97	21	321	8	304	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
3WSU_A	7.07e-94	22	320	38	333	Crystalstructure of beta-mannanase from Streptomyces thermolilacinus [Streptomyces thermolilacinus],3WSU_B Crystal structure of beta-mannanase from Streptomyces thermolilacinus [Streptomyces thermolilacinus]
4Y7E_A	5.65e-93	22	320	38	333	Crystalstructure of beta-mannanase from Streptomyces thermolilacinus with mannohexaose [Streptomyces thermolilacinus],4Y7E_B Crystal structure of beta-mannanase from Streptomyces thermolilacinus with mannohexaose [Streptomyces thermolilacinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PF24	1.45e-132	21	369	47	399	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P51529	5.58e-113	22	361	39	379	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
P22533	5.40e-90	42	313	55	326	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2
G1K3N4	5.35e-89	21	321	1	297	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998916	0.000211	0.000157	0.000163	0.000167

TMHMM  Annotations     

start	end
7	29