CAZyme Information: MGYG000001713_02311

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_02311
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	MGYG000001713_14|CGC5	24373.38	9.6114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 274611; End: 275261 Strand: -

Full Sequence      

MTAIVLTLGVPVVLVMVLKFVNPPFWGWQVSRMLFPPQGYPSHTQHQWIPLASASPLLPL
AVMASEDQRFPEHWGIDTHALASVIKNRGENGPDRGASTITQQTAKNVFLFPSHTYVRKA
YELYISLLLELIWGKARIMEMYLNVVEFGPGIYGIQAASEHYFGVSAAHLTRYQAAQLAV
VLPNPYRIQPYPMTQYVQQRVNWVLRQMQNLGAVAL

Enzyme Prediction     

No EC number prediction in MGYG000001713_02311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	209	5.9e-54	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	3.05e-104	3	216	15	231	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	4.06e-70	42	209	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	1.58e-66	11	212	18	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.70e-66	38	214	68	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.68e-46	47	214	3	171	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC95633.1	5.35e-156	1	216	10	225
ADT88786.1	1.09e-154	1	216	6	221
QUF71742.1	1.05e-144	1	216	1	216
QTG94723.1	1.62e-144	1	216	13	228
QKE36452.1	2.69e-143	1	216	13	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.02e-24	61	214	35	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.43e-24	61	214	35	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	5.18e-20	22	210	132	325	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	5.22e-20	22	210	153	346	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
4OON_A	7.14e-20	61	214	54	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87FR1	6.05e-94	11	216	20	225	Biosynthetic peptidoglycan transglycosylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=mtgA PE=3 SV=1
Q8EB02	4.69e-71	15	216	26	226	Biosynthetic peptidoglycan transglycosylase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mtgA PE=3 SV=2
A0KK53	4.05e-70	12	216	25	228	Biosynthetic peptidoglycan transglycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mtgA PE=3 SV=1
A1S3J2	3.59e-63	13	216	39	241	Biosynthetic peptidoglycan transglycosylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mtgA PE=3 SV=1
A6VRW7	3.07e-57	45	212	49	216	Biosynthetic peptidoglycan transglycosylase OS=Marinomonas sp. (strain MWYL1) OX=400668 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27