CAZyme Information: MGYG000001713_02691

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_02691
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000001713_14|CGC12	83779.98	5.8668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 687472; End: 689661 Strand: -

Full Sequence      

MKTTKKKPSKQQQAYLQLSRAAFADPFAFLGPYITGEHDALRVWMPGADGVELVIDGEPR
IALAREDESGFVLKSSRDLRFTHYQLAVNWAGVEQLIDDPYQYHSIYAEFDDLHTPKQMY
HFLGSHFTTQERDGKQITGVRFLVYAPHASSCSVIGSFNQWDGRRHPMQRLDYGIWGLFI
PGLEAGAQYKFELKGPNGEGLPHKADPWGSYAEQYPSFASVVYDHDAYQWQDAVWQTRPV
TEKRKEALSFYELHAGSWKRGEDGRFLNYRELADQLVPYLVDMGYTHVELMPVSEHPFYG
SWGYQPVGLFAPTSRYGTPDDFKYFVDACHQAGLGVVLDWVPAHFPSDDHGLANFDGTPL
YHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEMFHIDGIRVDAVASMLYLDYS
RSHDQWIPNVDGGRENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLG
FGFKWNMGWMHDSLSYIQEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLI
YKMPGDEWQQTANMRAYLGYMYGQPGKKLNFMGAEIAQTAEWNHDDQLQWFLLDFPRHKG
VQSLVRDLNHLYRHEAALHELDCDPKGYEWRLQDSAEASVIAHERFSENGERILVVTNFT
PVPHESFRLGVPNTGRYQLLLNSDATQYGGSGFEVNTLVATEKVASEGLPQSLKLRVPPL
ATLMYKLID

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	278	578	2.1e-158	0.9966777408637874
CBM48	123	212	5.7e-16	0.8552631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	118	726	22	626	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	102	727	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	84	726	579	1221	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	121	724	25	618	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	17	727	8	723	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC94935.1	0.0	1	729	1	729
QTG93760.1	0.0	1	729	1	729
ARK19414.1	0.0	1	729	1	729
QUF70776.1	0.0	1	729	1	729
QTH06575.1	0.0	1	729	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	4.79e-234	120	723	6	605	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	5.71e-234	120	723	11	610	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
5GQW_A	2.64e-219	25	727	40	773	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	7.49e-219	25	727	40	773	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	7.49e-219	25	727	40	773	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87FR0	0.0	4	727	30	753	1,4-alpha-glucan branching enzyme GlgB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=glgB PE=3 SV=1
Q5DZB8	0.0	16	727	1	714	1,4-alpha-glucan branching enzyme GlgB OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=glgB PE=3 SV=1
Q6LHN1	0.0	16	722	1	707	1,4-alpha-glucan branching enzyme GlgB OS=Photobacterium profundum (strain SS9) OX=298386 GN=glgB PE=3 SV=1
Q7MG90	0.0	17	727	4	714	1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=glgB PE=3 SV=2
Q8D4P0	0.0	17	728	4	715	1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999988	0.000061	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_02691.