CAZyme Information: MGYG000001713_02968

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_02968
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001713_14|CGC14	44124.9	4.8493

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 1001477; End: 1002619 Strand: -

Full Sequence      

MKVFPVKHSSLLRRVERTHPRHVVVDKITNLIDNLINIQDHTGEFLLHLDDGRTIDTKGW
AGWEWTHGIGLYGMYKYYQQTNDLNVLNIIDEWFEDRFAEEQATKNVNTVCPFLTLAYRY
EETGDQSLIPYLETWADYVMYQMPRTQSGGIQHIVYNSENPEQMWDDTLMMSVMPLTKIG
LLLDRPEYVEEAKYQFLTHIQYLTDRETGVWFHGWTFEGNHNFANARWARGNSWVTIVIP
DFLELLNLPEHDAYRRHLIHILNRQVEALAQYQQPGGLWNTLLDDSNSYVEASATAGFAY
GILKAVRMRYIDAKYADMAHKAVDALISDYINDAGELINVSFGTAMGSDLDYYREIPLTS
MPYGQAMAILCLSEYLRTYL

Enzyme Prediction     

No EC number prediction in MGYG000001713_02968.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	377	9.2e-111	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.51e-111	30	380	3	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.50e-107	37	379	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADT89422.1	5.43e-277	1	380	1	380
QDC95193.1	5.43e-277	1	380	1	380
QSV16265.1	1.87e-252	1	380	1	380
QIH43092.1	5.73e-247	1	380	1	380
QOT69939.1	8.05e-230	24	380	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	8.72e-176	3	379	5	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.99e-174	2	379	5	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.39e-131	27	380	11	373	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	2.16e-14	187	358	224	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.31e-44	26	378	9	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.38e-10	180	322	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.38e-10	180	322	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	4.73e-09	165	376	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_02968.